SLC66A2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SLC66A2 Polyclonal antibody, PBS Only (32069-1-PBS)

• 

  WB analysis using 32069-1-AP (same clone as 32069-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32069-1-AP (SLC66A2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32069-1-PBS in a different storage buffer formulation.

SLC66A2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 32069-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

Solute carrier family 66 member 2, PQ-loop repeat-containing protein 1, PQLC1

---

Product Information

32069-1-PBS targets SLC66A2 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34417

  Product name: Recombinant human SLC66A2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 188-231 aa of BC030140

  Sequence: PQLYRNHRHQSTEGMSIKMVLMWTSGDAFKTAYFLLKGAPLQFS

• Full Name: Solute carrier family 66 member 2
• Calculated Molecular Weight: 30 kDa, 271 aa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC030140
• Gene Symbol: PQLC1
• Gene ID (NCBI): 80148
• RRID: AB_3670184
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8N2U9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SLC66A2 is a member of the solute carrier (SLC) family, which plays a significant role in the transport of a variety of molecules across cell and organelle membranes. SLC66A2 is predicted to be involved in phospholipid translocation and retrograde transport, specifically from the endosome to the Golgi apparatus.