SLC6A14 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SLC6A14 Polyclonal antibody, PBS Only (18388-1-PBS)

• 

  IHC staining of mouse lung using 18388-1-AP (same clone as 18388-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 18388-1-AP (SLC6A14 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18388-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 18388-1-AP (same clone as 18388-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 18388-1-AP (SLC6A14 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18388-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse lung using 18388-1-AP (same clone as 18388-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse lung tissue using SLC6A14 antibody (18388-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18388-1-PBS in a different storage buffer formulation.

SLC6A14 Polyclonal Antibody for IHC, IF-P, Indirect ELISA

Cat No. 18388-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF-P, Indirect ELISA

Synonyms

---

Product Information

18388-1-PBS targets SLC6A14 in IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12857

  Product name: Recombinant human SLC6A14 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 138-264 aa of BC093710

  Sequence: YSLYYMFASFQSELPWKNCSSWSDKNCSRSPIVTHCNVSTVNKGIQEIIQMNKSWVDINNFTCINGSEIYQPGQLPSEQYWNKVALQRSSGMNETGVIVWYLALCLLLAWLIVGAALFKGIKSSGKV

• Full Name: solute carrier family 6 (amino acid transporter), member 14
• Calculated Molecular Weight: 642 aa, 72 kDa
• GenBank Accession Number: BC093710
• Gene Symbol: SLC6A14
• Gene ID (NCBI): 11254
• RRID: AB_3085563
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UN76
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Sodium- and chloride-dependent neutral and basic amino acid transporter B(0+) (SLC6A14) is a member of the Na+- and Cl−-dependent neurotransmitter transporter family and transports both neutral and cationic amino acids in an Na+- and Cl−-dependent manner.