SLC6A9 / GlyT1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SLC6A9 / GlyT1 Polyclonal antibody (30971-1-AP)

SLC6A9 / GlyT1 Polyclonal Antibody for WB, ELISA

Cat No. 30971-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, ELISA

Synonyms

GlyT1, GlyT-1, SLC6A9, Sodium- and chloride-dependent glycine transporter 1, Solute carrier family 6 member 9

• 

  WB analysis using 30971-1-AP

  BxPC-3 cells lysates were subjected to SDS PAGE followed by western blot with 30971-1-AP (SLC6A9 / GlyT1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SLC6A9 / GlyT1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: BxPC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30971-1-AP targets SLC6A9 / GlyT1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34437

  Product name: Recombinant human SLC6A9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 209-285 aa of NM_201649

  Sequence: SSMTHVLPWAYCNNPWNTHDCAGVLDASNLTNGSRPAALPSNLSHLLNHSLQRTSPSEEYWRLYVLKLSDDIGNFGE

• Full Name: solute carrier family 6 (neurotransmitter transporter, glycine), member 9
• Calculated Molecular Weight: 706 aa, 78 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: NM_201649
• Gene Symbol: SLC6A9
• Gene ID (NCBI): 6536
• RRID: AB_3669799
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P48067
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC6A9, also named glycine transporter 1 (GlyT1), is a transporter protein of the SLC6 family of sodium- and chloride-dependent neurotransmitter transporters. GlyT1 is the main regulator of synaptic glycine concentrations, assisted by the neuronal GlyT2 (PMID: 28828604). The 55-60 kDa band is the partially glycosylated form of GlyT1 (PMID: 27874011, PMID: 8995423).

Publications

What published studies show

The SLC6A9/GlyT1 Polyclonal antibody (Cat# 30971-1-AP) has 2 total citations. These appear in Cell Reports and Nan Fang Yi Ke Da Xue Xue Bao (Journal of Southern Medical University). The cited research spans immunology/inflammation (macrophage glycine transport modulating IL-1β production via the AKT1/mTOR/NLRP3 pathway in mice) and developmental neuroscience (prenatal fear stress disrupting placental amino acid transport in rats). Both studies utilized the antibody for Western blot applications.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cell Rep; Macrophage glycine transporter supports IL-1β production by modulating the AKT1/mTOR/NLRP3 pathway.; Authors - Yan Guo
rat	WB	Nan Fang Yi Ke Da Xue Xue Bao; [Prenatal fear stress impairs cognitive development in offspring rats by disrupting placental amino acid transport].; Authors - DU Zhixin