SLC7A4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SLC7A4 Polyclonal antibody, PBS Only (15748-1-PBS)

• 

  WB analysis of mouse brain using 15748-1-AP (same clone as 15748-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 15748-1-AP (SLC7A4 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15748-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human liver using 15748-1-AP (same clone as 15748-1-PBS)

  human liver tissue were subjected to SDS PAGE followed by western blot with 15748-1-AP (SLC7A4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15748-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 15748-1-AP (same clone as 15748-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15748-1-AP (SLC7A4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15748-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 15748-1-AP (same clone as 15748-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15748-1-AP (SLC7A4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15748-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 15748-1-AP (same clone as 15748-1-PBS)

  Immunofluorescent analysis of Hela cells, using SLC7A4 antibody 15748-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). This data was developed using the same antibody clone with 15748-1-PBS in a different storage buffer formulation.

SLC7A4 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 15748-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

15748-1-PBS targets SLC7A4 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8211

  Product name: Recombinant human SLC7A4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 415-635 aa of BC008814

  Sequence: QKSSPPSSPGPASPGPLTKQQSSFSDHLQLVGTVHASVPEPGELKPALRPYLGFLDGYSPGAVVTWALGVMLASAITIGCVLVFGNSTLHLPHWGYILLLLLTSVMFLLSLLVLGAHQQQYREDLFQIPMVPLIPALSIVLNICLMLKLSYLTWVRFSIWLLMGLAVYFGYGIRHSKENQRELPGLNSTHYVVFPRGSLEETVQAMQPPSQAPAQDPGHME

• Full Name: solute carrier family 7 (cationic amino acid transporter, y+ system), member 4
• Calculated Molecular Weight: 635 aa, 68 kDa
• Observed Molecular Weight: 68 kDa
• GenBank Accession Number: BC008814
• Gene Symbol: SLC7A4
• Gene ID (NCBI): 6545
• RRID: AB_2190966
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43246
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.