SLC7A8 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SLC7A8 Polyclonal antibody, PBS Only (30211-1-PBS)

• 

  WB analysis using 30211-1-AP (same clone as 30211-1-PBS)

  JAR cells were subjected to SDS PAGE followed by western blot with 30211-1-AP (SLC7A8 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30211-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 30211-1-AP (same clone as 30211-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30211-1-AP (SLC7A8 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30211-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 30211-1-AP (same clone as 30211-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using SLC7A8 antibody (30211-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 30211-1-PBS in a different storage buffer formulation.

SLC7A8 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 30211-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

30211-1-PBS targets SLC7A8 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32957

  Product name: Recombinant human SLC7A8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 468-535 aa of

  Sequence: YWQHKPKCFSDFIELLTLVSQKMCVVVYPEVERGSGTEEANEDMEEQQQPMYQPTPTKDKDVAGQPQP

• Full Name: solute carrier family 7 (cationic amino acid transporter, y+ system), member 8
• Calculated Molecular Weight: 58 kDa
• Observed Molecular Weight: 45-50 kDa
• Gene Symbol: SLC7A8
• Gene ID (NCBI): 23428
• RRID: AB_3086264
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UHI5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Solute carrier family 7 member 8 (SLC7A8), also known as LAT2, is an amino acid transporter that, together with LAT1 (SLC7A5), facilitates the bidirectional transport of branched-chain and aromatic AAs across the plasma membrane.