SLC8A2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SLC8A2 Polyclonal antibody, PBS Only (31437-1-PBS)

• 

  IHC staining of rat kidney using 31437-1-AP (same clone as 31437-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 31437-1-AP (SLC8A2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31437-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat kidney using 31437-1-AP (same clone as 31437-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 31437-1-AP (SLC8A2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31437-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat cerebellum using 31437-1-AP (same clone as 31437-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat cerebellum tissue using SLC8A2 antibody (31437-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31437-1-PBS in a different storage buffer formulation.

SLC8A2 Polyclonal Antibody for IHC, IF-P, Indirect ELISA

Cat No. 31437-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

IHC, IF-P, Indirect ELISA

Synonyms

Sodium/calcium exchanger 2, NCX2, KIAA1087

---

Product Information

31437-1-PBS targets SLC8A2 in IHC, IF-P, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34438

  Product name: Recombinant human SLC8A2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 21-68 aa of NM_015063

  Sequence: AATPTPSLPPPPANDSDTSTGGCQGSYRCQPGVLLPVWEPDDPSLGDK

• Full Name: solute carrier family 8 (sodium/calcium exchanger), member 2
• Calculated Molecular Weight: 921 aa, 100 kDa
• GenBank Accession Number: NM_015063
• Gene Symbol: SLC8A2
• Gene ID (NCBI): 6543
• RRID: AB_3742428
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9UPR5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SLC8A2, or solute carrier family 8 member 2, belongs to the SLC8 gene family, which encodes sodium-calcium exchangers (NCX). These proteins are part of the CaCA (Ca2+/Cation Antiporter) superfamily and play a significant role in regulating Ca2+-dependent events in many cell types. SLC8A2 has been implicated in various diseases, such as heart failure, arrhythmia, cerebral ischemia, hypertension, diabetes, and muscle dystrophy.