CoraLite® Plus 488-conjugated SLC9A9 Monoclonal antibody

• 

  WB analysis using CL488-66577

  Various lysates were subjected to SDS PAGE followed by western blot with CL488-66577 (SLC9A9 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

SLC9A9 Monoclonal Antibody for WB

Cat No. CL488-66577

Clone No.1B8D9

Host / Isotype

Mouse / IgG2a

Reactivity

Human, Mouse, Rat

Applications

WB

Synonyms

FLJ35613, Na(+)/H(+) exchanger 9, Nbla00118, NHE 9, NHE9, SLC9A9, Sodium/hydrogen exchanger 9

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66577 targets SLC9A9 in WB applications and shows reactivity with Human, Mouse, Rat samples.

• Tested Reactivity: Human, Mouse, Rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4660

  Product name: Recombinant human SLC9A9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 481-645 aa of BC035779

  Sequence: TPMLTWLQIRVGVDLDENLKEDPSSQHQEANNLDKNMTKAESARLFRMWYSFDHKYLKPILTHSGPPLTTTLPEWCGPISRLLTSPQAYGEQLKEDDVECIVNQDELAINYQEQASSPCSPPARLGLDQKASPQTPGKENIYEGDLGLGGYELKLEQTLGQSQLN

• Full Name: solute carrier family 9 (sodium/hydrogen exchanger), member 9
• Calculated Molecular Weight: 645 aa, 73 kDa
• Observed Molecular Weight: 73 kDa
• GenBank Accession Number: BC035779
• Gene Symbol: SLC9A9
• Gene ID (NCBI): 285195
• RRID: AB_2919346
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8IVB4
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.