Product Information
24584-1-PBS targets SLCO4C1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20177 Product name: Recombinant human SLCO4C1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-105 aa of BC152989 Sequence: MKSAKGIENLAFVPSSPDILRRLSASPSQIEVSALSSDPQRENSQPQELQKPQEPQKSPEPSLPSAPPNVSEEKLRSLSLSEFEEGSYGWRNFHPQCLQRCNTPG Predict reactive species |
| Full Name | solute carrier organic anion transporter family, member 4C1 |
| Calculated Molecular Weight | 724 aa, 79 kDa |
| Observed Molecular Weight | 60-85 kDa |
| GenBank Accession Number | BC152989 |
| Gene Symbol | SLCO4C1 |
| Gene ID (NCBI) | 353189 |
| RRID | AB_2879622 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q6ZQN7 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
SLCO4C1 is the only OATP ( organic anion transporting polypeptide) expressed at the human kidney's basolateral side of proximal tubular cells and mediates the excretion of uremic toxins (PMID: 21656517).





