SLCO4C1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SLCO4C1 Polyclonal antibody, PBS Only (24584-1-PBS)

• 

  WB analysis using 24584-1-AP (same clone as 24584-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24584-1-AP (SLCO4C1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24584-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 24584-1-AP (same clone as 24584-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 24584-1-AP (SLCO4C1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24584-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 24584-1-AP (same clone as 24584-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 24584-1-AP (SLCO4C1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24584-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SLCO4C1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 24584-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

24584-1-PBS targets SLCO4C1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20177

  Product name: Recombinant human SLCO4C1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-105 aa of BC152989

  Sequence: MKSAKGIENLAFVPSSPDILRRLSASPSQIEVSALSSDPQRENSQPQELQKPQEPQKSPEPSLPSAPPNVSEEKLRSLSLSEFEEGSYGWRNFHPQCLQRCNTPG

• Full Name: solute carrier organic anion transporter family, member 4C1
• Calculated Molecular Weight: 724 aa, 79 kDa
• Observed Molecular Weight: 60-85 kDa
• GenBank Accession Number: BC152989
• Gene Symbol: SLCO4C1
• Gene ID (NCBI): 353189
• RRID: AB_2879622
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6ZQN7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SLCO4C1 is the only OATP ( organic anion transporting polypeptide) expressed at the human kidney's basolateral side of proximal tubular cells and mediates the excretion of uremic toxins (PMID: 21656517).