SLFN12 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SLFN12 Polyclonal antibody, PBS Only (30550-1-PBS)

• 

  WB analysis using 30550-1-AP (same clone as 30550-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30550-1-AP (SLFN12 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30550-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse placenta using 30550-1-AP (same clone as 30550-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse placenta tissue slide using 30550-1-AP (SLFN12 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30550-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse placenta using 30550-1-AP (same clone as 30550-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse placenta tissue slide using 30550-1-AP (SLFN12 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30550-1-PBS in a different storage buffer formulation.

SLFN12 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 30550-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

EC:3.1.-.-, Ribonuclease SLFN12, Schlafen family member 12, SLFN3

---

Product Information

30550-1-PBS targets SLFN12 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31289

  Product name: Recombinant human SLFN12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 340-402 aa of BC035605

  Sequence: FMVEAEPKFSSSYEEVISQINTSLPAPHSWPLLEWQRQRHHCPGLSGRITYTPENLCRKLFLQ

• Full Name: schlafen family member 12
• Calculated Molecular Weight: 578 aa, 67 kDa
• Observed Molecular Weight: 67-70 kDa
• GenBank Accession Number: BC035605
• Gene Symbol: SLFN12
• Gene ID (NCBI): 55106
• RRID: AB_3742351
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IYM2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Schlafen family member 12 (SLFN12) is the only intermediate Schlafen protein expressed in humans (PMID: 31838790, PMID: 34571887). SLFN12 stimulates differentiation in enterocytes and prostate cancer cells, and its overexpression inhibits prostate cancer, triple-negative breast cancer (TNBC), and lung adenocarcinoma cell proliferation (PMID: 30045019, PMID: 24768141, PMID: 39594803). SLFN12 regulates human enterocytic differentiation by a pathway involving SERPB12, the deubiquitylases, and Cdx2 (PMID: 30045019). The expression of SLFN12 is increased throughout the process of T-cell activation (PMID: 28460425).