Product Information
30550-1-PBS targets SLFN12 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag31289 Product name: Recombinant human SLFN12 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 340-402 aa of BC035605 Sequence: FMVEAEPKFSSSYEEVISQINTSLPAPHSWPLLEWQRQRHHCPGLSGRITYTPENLCRKLFLQ Predict reactive species |
| Full Name | schlafen family member 12 |
| Calculated Molecular Weight | 578 aa, 67 kDa |
| Observed Molecular Weight | 67-70 kDa |
| GenBank Accession Number | BC035605 |
| Gene Symbol | SLFN12 |
| Gene ID (NCBI) | 55106 |
| RRID | AB_3742351 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8IYM2 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Schlafen family member 12 (SLFN12) is the only intermediate Schlafen protein expressed in humans (PMID: 31838790, PMID: 34571887). SLFN12 stimulates differentiation in enterocytes and prostate cancer cells, and its overexpression inhibits prostate cancer, triple-negative breast cancer (TNBC), and lung adenocarcinoma cell proliferation (PMID: 30045019, PMID: 24768141, PMID: 39594803). SLFN12 regulates human enterocytic differentiation by a pathway involving SERPB12, the deubiquitylases, and Cdx2 (PMID: 30045019). The expression of SLFN12 is increased throughout the process of T-cell activation (PMID: 28460425).





