SLITRK4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SLITRK4 Polyclonal antibody, PBS Only (13835-1-PBS)

• 

  WB analysis of mouse thymus using 13835-1-AP (same clone as 13835-1-PBS)

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 13835-1-AP (SLITRK4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13835-1-PBS in a different storage buffer formulation.

SLITRK4 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 13835-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

13835-1-PBS targets SLITRK4 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4781

  Product name: Recombinant human SLITRK4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 33-355 aa of BC040986

  Sequence: VSVENVLYVNCEKVSVYRPNQLKPPWSNFYHLNFQNNFLNILYPNTFLNFSHAVSLHLGNNKLQNIEGGAFLGLSALKQLHLNNNELKILRADTFLGIENLEYLQADYNLIKYIERGAFNKLHKLKVLILNDNLISFLPDNIFRFASLTHLDIRGNRIQKLPYIGVLEHIGRVVELQLEDNPWNCSCDLLPLKAWLENMPYNIYIGEAICETPSDLYGRLLKETNKQELCPMGTGSDFDVRILPPSQLENGYTTPNGHTTQTSLHRLVTKPPKTTNPSKISGIVAGKALSNRNLSQIVSYQTRVPPLTPCPAPCFCKTHPSDL

• Full Name: SLIT and NTRK-like family, member 4
• Calculated Molecular Weight: 837 aa, 94 kDa
• Observed Molecular Weight: 96 kDa
• GenBank Accession Number: BC040986
• Gene Symbol: SLITRK4
• Gene ID (NCBI): 139065
• RRID: AB_2190333
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IW52
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.