SLPI Recombinant monoclonal antibody

• 

  WB analysis of human saliva using 83965-4-RR

  human saliva were subjected to SDS PAGE followed by western blot with 83965-4-RR (SLPI antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of PC-3 using 83965-4-RR

  WB result of SLPI antibody (83965-4-RR; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SLPI transfected PC-3 cells.

• 

  IHC staining of human cervical cancer using 83965-4-RR

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 83965-4-RR (SLPI antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human cervical cancer using 83965-4-RR

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 83965-4-RR (SLPI antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  Affinity and Kinetic Characterization of 83965-4-RR

  Biolayer interferometry (BLl) kinetic assays of 83965-4-RR against Human SLPI were performed. The affinity constant is below 1 pM.

• Featured Product
• KD/KO Validated

SLPI Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 83965-4-RR

Clone No.241057F8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

241057F8, ALK1, ALP, Antileukoprotease, Antileukoproteinase

---

Tested Applications

• Positive WB detected in: human saliva, PC-3 cells
• Positive IHC detected in: human cervical cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83965-4-RR targets SLPI in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1673

  Product name: Recombinant human SLPI protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-132 aa of BC020708

  Sequence: MKSSGLFPFLVLLALGTLAPWAVEGSGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA

• Full Name: secretory leukocyte peptidase inhibitor
• Calculated Molecular Weight: 14 kDa
• Observed Molecular Weight: 14 kDa
• GenBank Accession Number: BC020708
• Gene Symbol: SLPI
• Gene ID (NCBI): 6590
• RRID: AB_3671543
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P03973
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLPI, a member of Whey acidic protein family, could mediate a variety of biological processes including cell proliferation and apoptosis, repairing reaction and immune response, with crucial roles in anti-protease, anti-inflammatory, anti-bacterial and anti-virus. SLPI is mainly expressed in epithelial cells.