SMAD2 Monoclonal antibody, PBS Only

• 

  WB analysis using 67343-1-Ig (same clone as 67343-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67343-1-Ig (SMAD2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 67343-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67343-1-Ig (same clone as 67343-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67343-1-Ig (SMAD2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67343-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67343-1-Ig (same clone as 67343-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67343-1-Ig (SMAD2 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67343-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67343-1-Ig (same clone as 67343-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67343-1-Ig (SMAD2 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67343-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 67343-1-Ig (same clone as 67343-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using SMAD2 antibody (67343-1-Ig, Clone: 2H10C7 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 67343-1-PBS in a different storage buffer formulation.

SMAD2 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 67343-1-PBS

Clone No.2H10C7

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

2H10C7, hMAD 2, hMAD-2, hSMAD2, JV18

---

Product Information

67343-1-PBS targets SMAD2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19542

  Product name: Recombinant human SMAD2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-355 aa of BC014840

  Sequence: MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDELEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLVPRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVDGFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAI

• Full Name: SMAD family member 2
• Calculated Molecular Weight: 467 aa, 52 kDa
• Observed Molecular Weight: 58 kDa
• GenBank Accession Number: BC014840
• Gene Symbol: SMAD2
• Gene ID (NCBI): 4087
• RRID: AB_2882601
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q15796
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SMAD2, also named as MADH2 and MADR2, belongs to the dwarfin/SMAD family, contains 1 MH1 (MAD homology 1) domain and 1 MH2 (MAD homology 2) domain. SMAD2 is a receptor-regulated SMAD(R-SMAD) that is an intracellular signal transducer and transcriptional modulator activated by TGF-beta and activin type 1 receptor kinases. This protein may act as a tumor suppressor in colorectal carcinoma. It is phosphorylated on one or several of Thr-220, Ser-245, Ser-250, and Ser-255. In response to TGF-beta, It is phosphorylated on Ser-465/467 by TGF-beta and activin type 1 receptor kinases, and then able to interact with SMURF2, recruiting other proteins, such as SNON, for degradation. In response to decorin, the naturally occurring inhibitor of TGF-beta signaling, it is phosphorylated on Ser-240 by CaMK2. It is phosphorylated by MAPK3 upon EGF stimulation; which increases transcriptional activity and stability, and is blocked by calmodulin. In response to TGF-beta, it is ubiquitinated by NEDD4L, which promotes its degradation. In response to TGF-beta signaling, it is acetylated on Lys-19 by coactivators, which increases transcriptional activity. The molecular weight of unphosphorylated forms of Smad2 is 52 kDa and phosphorylated forms of Smad2 is 58 kDa. (PMID: 9006934)