SMAD3 Recombinant monoclonal antibody

• 

  WB analysis using 87035-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87035-1-RR (SMAD3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse prostate using 87035-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse prostate tissue slide using 87035-1-RR (SMAD3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HEK-293 using 87035-1-RR

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using SMAD3 antibody (87035-1-RR, Clone: 251981H8 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  Affinity and Kinetic Characterization of 87035-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87035-1-RR against Human SMAD3 were performed. The affinity constant is 1.26 nM.

SMAD3 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 87035-1-RR

Clone No.251981H8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

hMAD 3, hMAD-3, hSMAD3, HSPC193, HsT17436

---

Tested Applications

• Positive WB detected in: HT-1080 cells, HeLa cells, HEK-293 cells, NIH/3T3 cells, mouse brain tissue, rat brain tissue
• Positive IHC detected in: mouse prostate tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87035-1-RR targets SMAD3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag32623

  Product name: Recombinant human SMAD3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 145-260 aa of NM_005902

  Sequence: EIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGF

• Full Name: SMAD family member 3
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: NM_005902
• Gene Symbol: SMAD3
• Gene ID (NCBI): 4088
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P84022
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SMAD3, also named as hMAD 3 or Mad3, is a 425 amino acid protein, which contains one MH1 domain and one MH2 domain. SMAD3 localizes in the nucleus and cytoplasm. SMAD3 plays an essential role in development and maintenance of self-tolerance and is a critical mediator of the TGFB signaling pathway. SMAD3 is involved in TGFB dependent regulation of steroidogenesis and in T-cell response to TGFB.