SMAD7 Monoclonal antibody

SMAD7 Monoclonal Antibody for WB, IF/ICC, FC (Intra), ELISA
Cat No. 68594-1-Ig
Clone No.3D1C3

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IF/ICC, FC (Intra), ELISA

MADH7, MAD homolog 8, MAD homolog 7, hSMAD7, CRCS3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inpig kidney tissue, mouse brain tissue, rat brain tissue, rabbit brain tissue
Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inU2OS cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68594-1-Ig targets SMAD7 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

Tested Reactivity human, mouse, rat, pig, rabbit
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag13688

Product name: Recombinant human SMAD7 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-426 aa of BC074819

Sequence: MFRTKRSALVRRLWRSRAPGGEDEEEGAGGGGGGGELRGEGATDSRAHGAGGGGPGRAGCCLGKAVRGAKGHHHPHPPAAGAGAAGGAEADLKALTHSVLKKLKERQLELLLQAVESRGGTRTACLLLPGRLDCRLGPGAPAGAQPAQPPSSYSLPLLLCKVFRWPDLRHSSEVKRLCCCESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTNYLAPGGLSDSQLLLEPGDRSHWCVVAYWEEKTRVGRLYCVQEPSLDIFYDLPQGNGFCLGQLNSDNKSQLVQKVRSKIGCGIQLTREVDGVWVYNRSSYPIFIKSATLDNPDSRTLLVHKVFPGFSIKAFDYEKAYSLQRPNDHEFMQQPWTGFTVQISFVKGWGQCYTRQFISSCPCWLEVIFNSR

Predict reactive species
Full Name SMAD family member 7
Calculated Molecular Weight 426 aa, 46 kDa
Observed Molecular Weight45-55 kDa
GenBank Accession NumberBC074819
Gene Symbol SMAD7
Gene ID (NCBI) 4092
RRIDAB_3085293
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO15105
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SMAD7, also named as Mothers against decapentaplegic homolog 7, is a 426 amino acid protein, which belongs to the dwarfin/SMAD family. SMAD7 Interaction with NEDD4L or RNF111 induces translocation from the nucleus to the cytoplasm (PubMed:16601693). TGF-beta stimulates its translocation from the nucleus to the cytoplasm. PDPK1 inhibits its translocation from the nucleus to the cytoplasm in response to TGF-beta (PubMed:17327236). SMAD7 as antagonist of signaling by TGF-beta type 1 receptor superfamily members has been shown to inhibit TGF-beta and activin signaling by associating with their receptors thus preventing SMAD2 access. SMAD7 functions as an adapter to recruit SMURF2 to the TGF-beta receptor complex and also acts by recruiting the PPP1R15A-PP1 complex to TGFBR1, which promotes its dephosphorylation. SMAD7 positively regulates PDPK1 kinase activity by stimulating its dissociation from the 14-3-3 protein YWHAQ which acts as a negative regulator.

Protocols

Product Specific Protocols
FC protocol for SMAD7 antibody 68594-1-IgDownload protocol
IF protocol for SMAD7 antibody 68594-1-IgDownload protocol
WB protocol for SMAD7 antibody 68594-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...