SMAD7 Monoclonal antibody, PBS Only

SMAD7 Monoclonal Antibody for WB, IF/ICC, FC (Intra), Indirect ELISA
Cat No. 68594-1-PBS
Clone No.3D1C3

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IF/ICC, FC (Intra), Indirect ELISA

MADH7, MAD homolog 8, MAD homolog 7, hSMAD7, CRCS3

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68594-1-PBS targets SMAD7 in WB, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

Tested Reactivity human, mouse, rat, pig, rabbit
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag13688

Product name: Recombinant human SMAD7 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-426 aa of BC074819

Sequence: MFRTKRSALVRRLWRSRAPGGEDEEEGAGGGGGGGELRGEGATDSRAHGAGGGGPGRAGCCLGKAVRGAKGHHHPHPPAAGAGAAGGAEADLKALTHSVLKKLKERQLELLLQAVESRGGTRTACLLLPGRLDCRLGPGAPAGAQPAQPPSSYSLPLLLCKVFRWPDLRHSSEVKRLCCCESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTNYLAPGGLSDSQLLLEPGDRSHWCVVAYWEEKTRVGRLYCVQEPSLDIFYDLPQGNGFCLGQLNSDNKSQLVQKVRSKIGCGIQLTREVDGVWVYNRSSYPIFIKSATLDNPDSRTLLVHKVFPGFSIKAFDYEKAYSLQRPNDHEFMQQPWTGFTVQISFVKGWGQCYTRQFISSCPCWLEVIFNSR

Predict reactive species
Full Name SMAD family member 7
Calculated Molecular Weight 426 aa, 46 kDa
Observed Molecular Weight45-55 kDa
GenBank Accession NumberBC074819
Gene Symbol SMAD7
Gene ID (NCBI) 4092
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO15105
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

SMAD7, also named as Mothers against decapentaplegic homolog 7, is a 426 amino acid protein, which belongs to the dwarfin/SMAD family. SMAD7 Interaction with NEDD4L or RNF111 induces translocation from the nucleus to the cytoplasm (PubMed:16601693). TGF-beta stimulates its translocation from the nucleus to the cytoplasm. PDPK1 inhibits its translocation from the nucleus to the cytoplasm in response to TGF-beta (PubMed:17327236). SMAD7 as antagonist of signaling by TGF-beta type 1 receptor superfamily members has been shown to inhibit TGF-beta and activin signaling by associating with their receptors thus preventing SMAD2 access. SMAD7 functions as an adapter to recruit SMURF2 to the TGF-beta receptor complex and also acts by recruiting the PPP1R15A-PP1 complex to TGFBR1, which promotes its dephosphorylation. SMAD7 positively regulates PDPK1 kinase activity by stimulating its dissociation from the 14-3-3 protein YWHAQ which acts as a negative regulator.

Loading...
||
New chat Able
正在加载,请稍候...