SMAGP Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SMAGP Polyclonal antibody, PBS Only (30910-1-PBS)

• 

  WB analysis using 30910-1-AP (same clone as 30910-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30910-1-AP (LOC57228 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30910-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 30910-1-AP (same clone as 30910-1-PBS)

  WB result of SMAGP antibody (30910-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-SMAGP transfected HeLa cells. This data was developed using the same antibody clone with 30910-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 30910-1-AP (same clone as 30910-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using LOC57228 antibody (30910-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 30910-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SMAGP Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 30910-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

LOC57228

---

Product Information

30910-1-PBS targets SMAGP in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34278

  Product name: Recombinant human LOC57228 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 43-97 aa of BC120965

  Sequence: VVFLTLLSVVILIFFYLYKNKGSYVTYEPTEGEPSAIVQMESDLAKGSEKEEYFI

• Full Name: small trans-membrane and glycosylated protein
• Observed Molecular Weight: 27-30 kDa
• GenBank Accession Number: BC120965
• Gene Symbol: SMAGP
• Gene ID (NCBI): 57228
• RRID: AB_3669781
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q0VAQ4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Small transmembrane and glycosylated protein (SMAGP) consists of 97 amino acids and contains a transmembrane domain. SMAGP localizes to the lateral face of the plasma membrane and is expressed in the cytoplasm after cell transformation. (PMID: 30410350)