SMAP1 Polyclonal antibody

• 

  WB analysis using 12799-1-AP

  Mouse brain tissue were subjected to SDS PAGE followed by western blot with 12799-1-AP (SMAP1 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NIH/3T3 using 12799-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 12799-1-AP (SMAP1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human adrenal gland using 12799-1-AP

  human adrenal gland tissue were subjected to SDS PAGE followed by western blot with 12799-1-AP (SMAP1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat lymph using 12799-1-AP

  rat lymph tissue were subjected to SDS PAGE followed by western blot with 12799-1-AP (SMAP1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human plasma using 12799-1-AP

  human plasma were subjected to SDS PAGE followed by western blot with 12799-1-AP (SMAP1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human stomach using 12799-1-AP

  Immunohistochemical analysis of paraffin-embedded normal stomach slide using 12799-1-AP (SMAP1 antibody) at dilution of 1:1200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach using 12799-1-AP

  Immunohistochemical analysis of paraffin-embedded normal stomach slide using 12799-1-AP (SMAP1 antibody) at dilution of 1:1200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SMAP1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 12799-1-AP

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

SMAP 1, Stromal membrane-associated protein 1

---

Tested Applications

• Positive WB detected in: mouse brain tissue, human adrenal gland tissue, human plasma sample, mouse brain tissue, rat lymph tissue
• Positive IHC detected in: human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunohistochemistry (IHC): IHC : 1:600-1:2400

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12799-1-AP targets SMAP1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3544

  Product name: Recombinant human SMAP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-287 aa of BC036123

  Sequence: MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTAEQIQCMQDMGNTKARLLYEANLPENFRRPQTDQAVEFFIRDKYEKKKYYDKNAIAITNISSSDAPLQPLVSSPSLQAAVDKNKLEKEKEKKKEEKKREKEPEKPAKPLTAEKLQKKDQQLEPKKSTSPKKAAEPTVDLLGLDGPAVAPVTNGNTTVPPLNDDLDIFGPMISNPLPATVMPPAQGTPSAPAAATLSTVTSGDLDLFTE

• Full Name: small ArfGAP 1
• Calculated Molecular Weight: 467 aa, 50 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC036123
• Gene Symbol: SMAP1
• Gene ID (NCBI): 60682
• RRID: AB_2272651
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IYB5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SMAP1, also named as FLJ13159 and SMAP 1, contains a Arf-GAP domain. SMAP1 is a GTPase activating protein for ARF6 that binds clathrin and regulates clathrin-dependent endocytosis. SMAP1 may play a role in erythropoiesis. This antibody is a rabbit polyclonal antibody raised against residues near the N terminus of human SMAP1.

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Kuldeep (Verified Customer) (12-11-2025)

Strong band around 50 KDa

• Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunoprecipitation
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: Hippocamus homogenate

SMAP1 Antibody Western Blot,Immunohistochemistry,Immunofluorescence,Immunoprecipitation validation (1:500 dilution) in Hippocamus homogenate (Cat no:12799-1-AP)