SMAP2 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• SMAP2 Recombinant monoclonal antibody, PBS Only (88105-1-PBS)

SMAP2 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 88105-1-PBS Copied!

Clone No. 260364G2

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

small ArfGAP2, SMAP1L, Stromal membrane-associated protein 1-like, Stromal membrane-associated protein 2

• 

  WB analysis using 88105-1-RR (same clone as 88105-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 88105-1-RR (SMAP2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 88105-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity of 88105-1-RR

  Biolayer interferometry (BLI) kinetic assays of 88105-1-RR against Human SMAP2 were performed. The affinity constant is 2.41 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SMAP2 in ?

Chat with Able

---

Product Information

88105-1-PBS targets SMAP2 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag9751

  Product name: Recombinant human SMAP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 77-429 aa of BC021133

  Sequence: QIQCMQEMGNGKANRLYEAYLPETFRRPQIDPAVEGFIRDKYEKKKYMDRSLDINAFRKEKDDKWKRGSEPVPEKKLEPVVFEKVKMPQKKEDPQLPRKSSPKSTAPVMDLLGLDAPVACSIANSKTSNTLEKDLDLLASVPSPSSSGSRKVVGSMPTAGSAGSVPENLNLFPEPGSKSEEIGKKQLSKDSILSLYGSQTPQMPTQAMFMAPAQMAYPTAYPSFPGVTPPNSIMGSMMPPPVGMVAQPGASGMVAPMAMPAGYMGGMQASMMGVPNGMMTTQQAGYMAGMAAMPQTVYGVQPAQQLQWNLTQMTQQMAGMNFYGANGMMNYGQSMSGGNGQAANQTLSPQMWK

• Full Name: small ArfGAP2
• Calculated Molecular Weight: 429 aa, 47 kDa
• Observed Molecular Weight: 47 kDa
• GenBank Accession Number: BC021133
• Gene Symbol: SMAP2
• Gene ID (NCBI): 64744
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8WU79
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SMAP2 (Small Arf GAP Protein 2) is an Arf1 GTPase-activating protein. It localizes to early endosomes/TGN, binds clathrin/AP-1, and regulates retrograde transport from recycling endosomes to the Golgi. Critical for vesicle trafficking, organelle homeostasis, and spermatogenesis. (PMID: 26136365)