Home
Products
Primary Antibodies
SMARCD2 Polyclonal antibody, PBS Only (11156-1-PBS)

Filter: AllWBIHC

WB analysis of RAW264.7 using 11156-1-AP (same clone as 11156-1-PBS)
RAW264.7 cells were subjected to SDS PAGE followed by western blot with 11156-1-AP (SMARCD2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11156-1-PBS in a different storage buffer formulation.
WB analysis of mouse thymus using 11156-1-AP (same clone as 11156-1-PBS)
mouse thymus tissue were subjected to SDS PAGE followed by western blot with 11156-1-AP (SMARCD2 antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11156-1-PBS in a different storage buffer formulation.
IHC staining of human cervical cancer using 11156-1-AP (same clone as 11156-1-PBS)
Immunohistochemical analysis of paraffin-embedded human cervical cancer using 11156-1-AP (SMARCD2 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11156-1-PBS in a different storage buffer formulation.
IHC staining of rat spleen using 11156-1-AP (same clone as 11156-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat spleen tissue slide using 11156-1-AP (SMARCD2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11156-1-PBS in a different storage buffer formulation.
IHC staining of rat spleen using 11156-1-AP (same clone as 11156-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat spleen tissue slide using 11156-1-AP (SMARCD2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11156-1-PBS in a different storage buffer formulation.
IHC staining of mouse spleen using 11156-1-AP (same clone as 11156-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 11156-1-AP (SMARCD2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11156-1-PBS in a different storage buffer formulation.
IHC staining of mouse spleen using 11156-1-AP (same clone as 11156-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 11156-1-AP (SMARCD2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11156-1-PBS in a different storage buffer formulation.

SMARCD2 Polyclonal antibody, PBS Only

Name: SMARCD2 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 11156-1-PBS

SMARCD2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 11156-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

11156-1-PBS targets SMARCD2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag1630 Product name: Recombinant human SMARCD2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-78 aa of BC018953 Sequence: RDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRLT Predict reactive species
Full Name	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2
Calculated Molecular Weight	52 kDa
Observed Molecular Weight	52 kDa
GenBank Accession Number	BC018953
Gene Symbol	SMARCD2
Gene ID (NCBI)	6603
RRID	AB_2192145
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q92925
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

The SWI/SNF chromatin remodelling complexes are important regulators of transcription; they consist of large multisubunit assemblies containing either Brm or Brg1 as the catalytic ATPase subunit and a variable subset of approximately 10 Brg/Brm-associated factors (BAF) [PMID:20148946]. SMARCD2 is one of BAF60 proteins, which are found in most complexes, is thought to bridge interactions between transcription factors and SWI/SNF complexes. [PMID:9427560]