Tested Applications
| Positive WB detected in | HeLa cells, BxPC-3 cells, NIH/3T3 cells, C6 cells |
| Positive IHC detected in | human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human heart tissue, mouse pancreas tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12838-1-AP targets SMARCD3 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3896 Product name: Recombinant human SMARCD3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-88 aa of BC002628 Sequence: MTPGLQHPPTVVQRPGMPSGARMPHQGAPMGPPGSPYMGSPAVRPGLAPAGMEPARKRAAPPPGQSQAQSQGQPVPTAPARSRSAKRR Predict reactive species |
| Full Name | SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3 |
| Calculated Molecular Weight | 54 kDa |
| Observed Molecular Weight | 54-55 kDa |
| GenBank Accession Number | BC002628 |
| Gene Symbol | SMARCD3 |
| Gene ID (NCBI) | 6604 |
| RRID | AB_2192157 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q6STE5 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SMARCD3 is a component of the SWI/SNF (mating type switching/sucrose non-fermenting) chromatin remodeling complex, which evolutionarily conserved from yeast to human, and all complexes contain a core set of conserved components, including BRG1/Brm-associated factors (BAFs) and a DNA-dependent SWI2/SNF2-like ATPase, which enables chromatin remodeling. SMARCD3 isoforms bind to several nuclear receptors and transcription factors of various families. SMARCD3 proteins interact in a ligand-independent manner with peroxisome proliferator- activated receptor gamma and enhance its transcriptional activity.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SMARCD3 antibody 12838-1-AP | Download protocol |
| IHC protocol for SMARCD3 antibody 12838-1-AP | Download protocol |
| WB protocol for SMARCD3 antibody 12838-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The antibody (catalog #12838-1-AP) has 6 total citations published in Cell Discovery, Nature Cardiovascular Research, Cardiovascular Research, Cells, Translational Oncology, and Prostate. Associated research fields include gastric cancer, cardiac reprogramming, embryonic cardiomyogenesis, prostate cancer, melanoma, and SWI/SNF chromatin remodeling regulation. All studies used Western blot; one additionally employed IHC. Tested species were human and mouse.
| Species | Application | Title |
|---|---|---|
Cell Discov m6Am methyltransferase PCIF1 is essential for aggressiveness of gastric cancer cells by inhibiting TM9SF1 mRNA translation. | ||
Nat Cardiovasc Res Translational landscape of direct cardiac reprogramming reveals a role of Ybx1 in repressing cardiac fate acquisition | ||
Cardiovasc Res The G protein coupled receptor Apj is expressed in the second heart field and regulates Cerberus-Baf60C axis in embryonic stem cell cardiomyogenesis. | ||
Cells The SMARCD Family of SWI/SNF Accessory Proteins Is Involved in the Transcriptional Regulation of Androgen Receptor-Driven Genes and Plays a Role in Various Essential Processes of Prostate Cancer | ||
Transl Oncol SNF5, a core subunit of SWI/SNF complex, regulates melanoma cancer cell growth, metastasis, and immune escape in response to matrix stiffness. | ||
Prostate Low SMARCD3 expression is associated with poor prognosis in patients with prostate cancer |
