SMEK2 Polyclonal antibody

• 

  WB analysis of HEK-293 using 20348-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 20348-1-AP (SMEK2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 20348-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 20348-1-AP (SMEK2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A2780 using 20348-1-AP

  A2780 cells were subjected to SDS PAGE followed by western blot with 20348-1-AP (SMEK2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 20348-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 20348-1-AP (SMEK2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human cervical cancer using 20348-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer using 20348-1-AP (SMEK2 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human cervical cancer using 20348-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer using 20348-1-AP (SMEK2 antibody) at dilution of 1:100 (under 40x lens).

• 

  IF Staining of HEK-293 using 20348-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HEK-293 cells using 20348-1-AP (SMEK2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

SMEK2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 20348-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

FLFL2, KIAA1387, PP4R3B, PPP4R3B, PSY2, SMEK homolog 2, SMEK2, smk1

---

Tested Applications

• Positive WB detected in: HEK-293 cells, A2780 cells, HeLa cells, MCF-7 cells
• Positive IHC detected in: human cervical cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

20348-1-AP targets SMEK2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14156

  Product name: Recombinant human SMEK2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 589-738 aa of BC060855

  Sequence: GLKTKYEQEKDRQNQKLNSVPSILRSNRFRRDAKALEEDEEMWFNEDEEEEGKAVVAPVEKPKPEDDFPDNYEKFMETKKAKESEDKENLPKRTSPGGFKFTFSHSASAANGTNSKSVVAQIPPATSNGSSSKTTNLPTSVTATKGSLVG

• Full Name: SMEK homolog 2, suppressor of mek1 (Dictyostelium)
• Calculated Molecular Weight: 849 aa, 97 kDa
• Observed Molecular Weight: 94-97 kDa, 87 kDa
• GenBank Accession Number: BC060855
• Gene Symbol: SMEK2
• Gene ID (NCBI): 57223
• RRID: AB_10694150
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5MIZ7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Oncol Lett; AMPK decreases ERK1/2 activity and cancer cell sensitivity to nutrition deprivation by mediating a positive feedback loop involving eEF2K.; Authors - Shujuan Tong
human	WB	Exp Cell Res; Protein phosphatase 4 mediates palmitic acid-induced endothelial dysfunction by decreasing eNOS phosphorylation at serine 633 in HUVECs; Authors - Zhengwei Liang