SMEK2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SMEK2 Polyclonal antibody, PBS Only (20348-1-PBS)

• 

  WB analysis of HEK-293 using 20348-1-AP (same clone as 20348-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 20348-1-AP (SMEK2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20348-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A2780 using 20348-1-AP (same clone as 20348-1-PBS)

  A2780 cells were subjected to SDS PAGE followed by western blot with 20348-1-AP (SMEK2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20348-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 20348-1-AP (same clone as 20348-1-PBS)

  MCF7 cells were subjected to SDS PAGE followed by western blot with 20348-1-AP (SMEK2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20348-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 20348-1-AP (same clone as 20348-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 20348-1-AP (SMEK2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20348-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 20348-1-AP (same clone as 20348-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer using 20348-1-AP (SMEK2 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 20348-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 20348-1-AP (same clone as 20348-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer using 20348-1-AP (SMEK2 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 20348-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 20348-1-AP (same clone as 20348-1-PBS)

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HEK-293 cells using 20348-1-AP (SMEK2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 20348-1-PBS in a different storage buffer formulation.

SMEK2 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 20348-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

20348-1-PBS targets SMEK2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14156

  Product name: Recombinant human SMEK2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 589-738 aa of BC060855

  Sequence: GLKTKYEQEKDRQNQKLNSVPSILRSNRFRRDAKALEEDEEMWFNEDEEEEGKAVVAPVEKPKPEDDFPDNYEKFMETKKAKESEDKENLPKRTSPGGFKFTFSHSASAANGTNSKSVVAQIPPATSNGSSSKTTNLPTSVTATKGSLVG

• Full Name: SMEK homolog 2, suppressor of mek1 (Dictyostelium)
• Calculated Molecular Weight: 849 aa, 97 kDa
• Observed Molecular Weight: 94-97 kDa, 87 kDa
• GenBank Accession Number: BC060855
• Gene Symbol: SMEK2
• Gene ID (NCBI): 57223
• RRID: AB_10694150
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5MIZ7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.