SMIM17 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SMIM17 Polyclonal antibody (34127-1-AP)

• 

  WB analysis using 34127-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 34127-1-AP (SMIM17 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of rat brain using 34127-1-AP

  IP result of anti-SMIM17 (IP:34127-1-AP, 4ug; Detection:34127-1-AP 1:600) with rat brain tissue lysate 1720 ug.

• 

  IP experiment of mouse brain using 34127-1-AP

  IP result of anti-SMIM17 (IP:34127-1-AP, 4ug; Detection:34127-1-AP 1:600) with mouse brain tissue lysate 1960 ug.

SMIM17 Polyclonal Antibody for WB, IP, ELISA

Cat No. 34127-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, ELISA

Synonyms

SIM17, Small integral membrane protein 17

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IP detected in: mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

34127-1-AP targets SMIM17 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag41690

  Product name: Recombinant human SMIM17 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-95 aa of NM_001193628

  Sequence: MQSLRPEQTRGLLEPERTKTLLPRESRAWEKPPHPACTKDWEAVEVGASSHDSDEKDLSSQETGLSQEWSSVEEDDESEGSQGFVEWSKAPQQTT

• Full Name: hypothetical protein LOC147670
• Calculated Molecular Weight: 118aa, 13 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: NM_001193628
• Gene Symbol: LOC147670
• Gene ID (NCBI): 147670
• RRID: AB_3743158
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P0DL12
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SMIM17 (Small Integral Membrane Protein 17) encodes a small integral membrane protein. It is predominantly expressed in the brain, with elevated levels in inhibitory and excitatory neurons, bipolar cells, and astrocytes. SMIM17 has been linked to endoplasmic reticulum‑stress‑induced apoptosis through its interaction with TMEM214 and CASP4, and has been suggested to play a role in neuronal synaptic function. Although its precise biological function remains largely unknown, it is considered a promising target for future neurobiological studies. SMIM17 is not currently recognized as a therapeutic drug target but has been identified in fusion events (e.g., AKT2‑SMIM17) in sarcoma and shows altered expression in certain cancers, making it a gene of interest in both basic neuroscience and oncology research.