SMMHC Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• SMMHC Recombinant monoclonal antibody, PBS Only (86654-3-PBS)

SMMHC Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 86654-3-PBS

Clone No.251604H2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

MYH11, KIAA0866, Myosin 11, Myosin heavy chain 11, Myosin-11

• 

  WB analysis of mouse heart using 86654-3-RR (same clone as 86654-3-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 86654-3-RR (MYH11 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86654-3-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 86654-3-RR (same clone as 86654-3-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 86654-3-RR (SMMHC antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86654-3-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 86654-3-RR (same clone as 86654-3-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 86654-3-RR (SMMHC antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86654-3-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity of 86654-3-RR

  Biolayer interferometry (BLl) kinetic assays of 86654-3-RR against Human SMMHC were performed. The affinity constant is 1.48 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

86654-3-PBS targets SMMHC in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag16114

  Product name: Recombinant human MYH11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1208-1316 aa of BC104906

  Sequence: LTEQLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHKKKKLEAQVQELQSKCSDGERARAELNDKVHKLQNEVESVTGMLNEAEGKAIKLAKDVASLSSQ

• Full Name: myosin, heavy chain 11, smooth muscle
• Calculated Molecular Weight: 1979 aa, 228 kDa
• Observed Molecular Weight: 227-250 kDa
• GenBank Accession Number: BC104906
• Gene Symbol: SMMHC/MYH11
• Gene ID (NCBI): 4629
• RRID: AB_3745033
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P35749
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SMMHC (smooth muscle myosin heavy chain; MYH11) is a contractile protein of smooth muscle cells. It is specifically expressed in cells derived from smooth muscle lineages. SMMHC is used as vascular smooth muscle cell (vSMC) contractile marker. It is also an excellent marker for myoepithelial cells, with no or few cross-reaction with myofibroblasts, thus very useful in the evaluation of stromal invasion.