Tested Applications
| Positive WB detected in | mouse heart tissue |
| Positive IHC detected in | human colon tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:2000-1:8000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
86654-3-RR targets SMMHC in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag16114 Product name: Recombinant human MYH11 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1208-1316 aa of BC104906 Sequence: LTEQLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHKKKKLEAQVQELQSKCSDGERARAELNDKVHKLQNEVESVTGMLNEAEGKAIKLAKDVASLSSQ Predict reactive species |
| Full Name | myosin, heavy chain 11, smooth muscle |
| Calculated Molecular Weight | 1979 aa, 228 kDa |
| Observed Molecular Weight | 227-250 kDa |
| GenBank Accession Number | BC104906 |
| Gene Symbol | SMMHC/MYH11 |
| Gene ID (NCBI) | 4629 |
| RRID | AB_3745033 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P35749 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SMMHC (smooth muscle myosin heavy chain; MYH11) is a contractile protein of smooth muscle cells. It is specifically expressed in cells derived from smooth muscle lineages. SMMHC is used as vascular smooth muscle cell (vSMC) contractile marker. It is also an excellent marker for myoepithelial cells, with no or few cross-reaction with myofibroblasts, thus very useful in the evaluation of stromal invasion.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for SMMHC antibody 86654-3-RR | Download protocol |
| WB protocol for SMMHC antibody 86654-3-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |







