SMN Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SMN Polyclonal antibody, PBS Only (11708-1-PBS)

• Featured Product
• KD/KO Validated

SMN Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 11708-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

C BCD541, Component of gems 1, Gemin 1, Gemin-1, SMN1

• 

  WB analysis of HeLa using 11708-1-AP (same clone as 11708-1-PBS)

  WB result of SMN antibody (11708-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SMN transfected HeLa cells. This data was developed using the same antibody clone with 11708-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 11708-1-AP (same clone as 11708-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 11708-1-AP (SMN antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11708-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse testis using 11708-1-AP (same clone as 11708-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 11708-1-AP (SMN antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11708-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 11708-1-PBS

  K-562 cells were subjected to SDS PAGE followed by western blot with 11708-1-AP (SMN antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HEK-293 using 11708-1-AP (same clone as 11708-1-PBS)

  IP result of anti-SMN (IP:11708-1-AP, 4ug; Detection:11708-1-AP 1:2000) with HEK-293 cells lysate 1040 ug. This data was developed using the same antibody clone with 11708-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 11708-1-AP (same clone as 11708-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 11708-1-AP (SMN antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 11708-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 11708-1-AP (same clone as 11708-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 11708-1-AP (SMN antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 11708-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 11708-1-AP (same clone as 11708-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 11708-1-AP (SMN antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11708-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 11708-1-AP (same clone as 11708-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 11708-1-AP (SMN antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11708-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 11708-1-AP (same clone as 11708-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 11708-1-AP (SMN antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11708-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 11708-1-AP (same clone as 11708-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 11708-1-AP (SMN antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11708-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 11708-1-AP (same clone as 11708-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11708-1-AP (SMN antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11708-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 11708-1-AP (same clone as 11708-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11708-1-AP (SMN antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11708-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 11708-1-AP (same clone as 11708-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta using 11708-1-AP (SMN antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 11708-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 11708-1-AP (same clone as 11708-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 11708-1-AP (SMN antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 11708-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin using 11708-1-AP (same clone as 11708-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin using 11708-1-AP (SMN antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 11708-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 11708-1-AP (same clone as 11708-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart using 11708-1-AP (SMN antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 11708-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 11708-1-AP (same clone as 11708-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 11708-1-AP (SMN antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 11708-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human spleen using 11708-1-AP (same clone as 11708-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen using 11708-1-AP (SMN antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 11708-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung using 11708-1-AP (same clone as 11708-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung using 11708-1-AP (SMN antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 11708-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary using 11708-1-AP (same clone as 11708-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary using 11708-1-AP (SMN antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 11708-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 11708-1-AP (same clone as 11708-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using SMN antibody (11708-1-AP) at dilution of 1:1500 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4). This data was developed using the same antibody clone with 11708-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

11708-1-PBS targets SMN in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2260

  Product name: Recombinant human SMN2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-282 aa of BC000908

  Sequence: MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMEMLA

• Full Name: survival of motor neuron 2, centromeric
• Calculated Molecular Weight: 282 aa, 30 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC000908
• Gene Symbol: SMN
• Gene ID (NCBI): 6607
• RRID: AB_2255114
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16637
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Spinal muscular atrophy (SMA) is an autosomal recessive neurodegenerative disease characterized by loss of anterior horn cells in the spinal cord and concomitant symmetrical muscle weakness and atrophy (PMID: 16364894 ). SMA is caused by deletion or mutations of the survival motor neuron (SMN1) gene. SMA patients lack a functional SMN1 gene, but they possess an intact SMN2 gene, which though nearly identical to SMN1, is only partially functional (PMID: 17355180). A large majority of SMN2 transcripts lack exon 7, resulting in production of a truncated, less stable SMN protein (PMID: 10369862). The level of SMN protein correlates with phenotypic severity of SMA. This antibody, 11708-1-AP, raised against the recombinant full-length human SMN2 protein, recognizes all isoforms of SMN protein.