• Featured Product
  • KD/KO Validated

SMN Polyclonal antibody

SMN Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 11708-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

C BCD541, Component of gems 1, Gemin 1, Gemin-1, SMN1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells, mouse testis tissue, HepG2 cells, Jurkat cells, K-562 cells
Positive IP detected inHEK-293 cells
Positive IHC detected inhuman kidney tissue, human brain tissue, human heart tissue, human lung tissue, human ovary tissue, human placenta tissue, human skin tissue, human spleen tissue, human testis tissue, mouse brain tissue, mouse kidney tissue, mouse liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:750-1:3000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11708-1-AP targets SMN in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2260

Product name: Recombinant human SMN2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-282 aa of BC000908

Sequence: MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMEMLA

Predict reactive species
Full Name survival of motor neuron 2, centromeric
Calculated Molecular Weight 282 aa, 30 kDa
Observed Molecular Weight 38 kDa
GenBank Accession NumberBC000908
Gene Symbol SMN
Gene ID (NCBI) 6607
RRIDAB_2255114
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ16637
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Spinal muscular atrophy (SMA) is an autosomal recessive neurodegenerative disease characterized by loss of anterior horn cells in the spinal cord and concomitant symmetrical muscle weakness and atrophy (PMID: 16364894 ). SMA is caused by deletion or mutations of the survival motor neuron (SMN1) gene. SMA patients lack a functional SMN1 gene, but they possess an intact SMN2 gene, which though nearly identical to SMN1, is only partially functional (PMID: 17355180). A large majority of SMN2 transcripts lack exon 7, resulting in production of a truncated, less stable SMN protein (PMID: 10369862). The level of SMN protein correlates with phenotypic severity of SMA. This antibody, 11708-1-AP, raised against the recombinant full-length human SMN2 protein, recognizes all isoforms of SMN protein.

Protocols

Product Specific Protocols
IF protocol for SMN antibody 11708-1-APDownload protocol
IHC protocol for SMN antibody 11708-1-APDownload protocol
IP protocol for SMN antibody 11708-1-APDownload protocol
WB protocol for SMN antibody 11708-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Nat Commun

SNUPN deficiency causes a recessive muscular dystrophy due to RNA mis-splicing and ECM dysregulation

Authors - Marwan Nashabat
mouseWB

Dev Cell

DDX20 is required for cell-cycle reentry of prospermatogonia and establishment of spermatogonial stem cell pool during testicular development in mice

Authors - Dingfeng Zou
humanWB

Hum Mol Genet

Low levels of Survival Motor Neuron protein are sufficient for normal muscle function in the SMNΔ7 mouse model of SMA.

Authors - Chitra C Iyer
mouseELISA

Hum Mol Genet

SMN expression is required in motor neurons to rescue electrophysiological deficits in the SMNΔ7 mouse model of SMA.

Authors - Vicki L McGovern
mouseELISA

Neurobiol Dis

Dual SMN inducing therapies can rescue survival and motor unit function in symptomatic ∆7SMA mice.

Authors - Kaitlyn M Kray
mouse,humanWB

Hum Mol Genet

Intragenic complementation of amino and carboxy terminal SMN missense mutations can rescue Smn null mice.

Authors - Vicki L McGovern
  • KO Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

jummoin (Verified Customer) (12-11-2025)

Good SMN antibody with clear, specific bands and reliable performance in WB and IF. Useful for studying SMN expression across different models.

  • Applications: Immunohistochemistry
FH

randi (Verified Customer) (12-11-2025)

Reliable SMN antibody that detects all SMN isoforms and works well in Western blot, IHC, IF, and IP with clear, specific results across human and rodent samples. Suitable for studies involving SMN protein expression in cellular and tissue analyses.

  • Applications: Immunohistochemistry
FH

Rachel (Verified Customer) (08-19-2019)

Worked well in MSD immunoassays and cell based assays.

  • Applications: Western Blot, Cell culture,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Fibroblasts
Loading...
||
New chat Able
正在加载,请稍候...