SMOC2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SMOC2 Polyclonal antibody, PBS Only (31063-1-PBS)

• 

  WB analysis using 31063-1-AP (same clone as 31063-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31063-1-AP (SMOC2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31063-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HCT 116 using 31063-1-AP (same clone as 31063-1-PBS)

  WB result of SMOC2 antibody (31063-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-SMOC2 transfected HCT 116 cells. This data was developed using the same antibody clone with 31063-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SMOC2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 31063-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

MSTP117, Secreted modular calcium-binding protein 2, SMAP 2, SMAP2, SMAP-2

---

Product Information

31063-1-PBS targets SMOC2 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34966

  Product name: Recombinant human SMOC2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 22-230 aa of BC047583

  Sequence: QKFSALTFLRVDQDKDKDCSLDCAGSPQKPLCASDGRTFLSRCEFQRAKCKDPQLEIAYRGNCKDVSRCVAERKYTQEQARKEFQQVFIPECNDDGTYSQVQCHSYTGYCWCVTPNGRPISGTAVAHKTPRCPGSVNEKLPQREGTGKTDDAAAPALETQPQGDEEDIASRYPTLWTEQVKSRQNKTNKNSVSSCDQEHQSALEEAKQP

• Full Name: SPARC related modular calcium binding 2
• Calculated Molecular Weight: 50 kDa
• Observed Molecular Weight: 49-50 kDa
• GenBank Accession Number: BC047583
• Gene Symbol: SMOC2
• Gene ID (NCBI): 64094
• RRID: AB_3669838
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9H3U7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Secreted modular calcium-binding protein 2 (SMOC2), which is a member of the secreted protein acidic and rich in cysteine (SPARC) family of matricellular proteins, interacts with matrix proteins, cell surface receptors, cytokines, proteasomes and other effector molecules to regulate cell-cell and cell-microenvironment communication (PMID: 36513634). It is expected to be located in extracellular space. The calculated molecular weight of SMOC2 is 50 kDa. In recent years, SMOC2 has been reported to be highly expressed in tumor tissues and to promote tumor migration, invasion and growth. In addition to its role in tumor progression, it also regulates wound healing, bone growth, fibrosis and embryogenesis (PMID: 36513634).