SMPD3 Polyclonal antibody

SMPD3 Polyclonal Antibody for WB, ELISA

Cat No. 25613-1-AP

Publications (1)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

EC:3.1.4.12, Neutral sphingomyelinase 2, Neutral sphingomyelinase II, nSMase 2, nSMase2

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWB

WB analysis using 25613-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 25613-1-AP (SMPD3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 25613-1-AP
K-562 cells were subjected to SDS PAGE followed by western blot with 25613-1-AP (SMPD3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 25613-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 25613-1-AP (SMPD3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SMPD3 in ?

Overview

Tested Applications
Product Information
Publications (1)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in

Neuro-2a cells, A549 cells, K-562 cells, mouse brain tissue, rat brain tissue

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

25613-1-AP targets SMPD3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag22487 Product name: Recombinant human SMPD3 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 540-655 aa of BC112238 Sequence: PGEEKPWAIGTLLDTNGLYDEDVCTPDNLQKVLESEEGRREYLAFPTSKSSGQKGRKELLKGNGRRIDYMLHAEEGLCPDWKAEVEEFSFITQLSGLTDHLPVAMRLMVSSGEEEA Predict reactive species
Full Name	sphingomyelin phosphodiesterase 3, neutral membrane (neutral sphingomyelinase II)
Calculated Molecular Weight	655 aa, 71 kDa
Observed Molecular Weight	70-71 kDa
GenBank Accession Number	BC112238
Gene Symbol	SMPD3
Gene ID (NCBI)	55512
RRID	AB_3742154
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9NY59
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SMPD3 (sphingomyelin phosphodiesterase 3), also called neutral sphingomyelinase-2 (nSMase2), is a Golgi-enriched, membrane-bound Zn²⁺-dependent hydrolase that converts sphingomyelin into ceramide and phosphocholine. Ceramide functions as a bioactive lipid second messenger that integrates cellular stress, apoptosis, autophagy and differentiation signals.

Protocols

Product Specific Protocols
WB protocol for SMPD3 antibody 25613-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The SMPD3 Polyclonal antibody (Cat# 25613-1-AP) has 1 citation. It was used in a Western blot study published in Journal of Endocrinology (2021), investigating ChREBP-β's role in regulating thermogenesis in brown adipose tissue. The research falls within the fields of endocrinology, lipid metabolism, and adipose tissue biology.