SMS Monoclonal antibody, PBS Only

• 

  WB analysis using 68040-1-Ig (same clone as 68040-1-PBS)

  A431 cells were subjected to SDS PAGE followed by western blot with 68040-1-Ig (SMS antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 68040-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 68040-1-Ig (same clone as 68040-1-PBS)

  WB result of SMS antibody (68040-1-Ig; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SMS transfected K-562 cells. This data was developed using the same antibody clone with 68040-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 68040-1-Ig (same clone as 68040-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using SMS antibody (68040-1-Ig, Clone: 1G8E9 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68040-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 68040-1-Ig (same clone as 68040-1-PBS)

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human SMS (68040-1-Ig, Clone:1G8E9) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG1 Isotype Control (MOPC-21) (65124-1-Ig, Clone: MOPC-21) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 68040-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SMS Monoclonal Antibody for WB, IF/ICC, FC (Intra), ELISA

Cat No. 68040-1-PBS

Clone No.1G8E9

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IF/ICC, FC (Intra), ELISA

Synonyms

Spermine synthase, 1G8E9, EC:2.5.1.22, MRSR, SPMSY

---

Product Information

68040-1-PBS targets SMS in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8840

  Product name: Recombinant human SMS protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-366 aa of BC009898

  Sequence: MAAARHSTLDFMLGAKADGETILKGLQSIFQEQGMAESVHTWQDHGYLATYTNKNGSFANLRIYPHGLVLLDLQSYDGDAQGKEEIDSILNKVEERMKELSQDSTGRVKRLPPIVRGGAIDRYWPTADGRLVEYDIDEVVYDEDSPYQNIKILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKDVLILGGGDGGILCEIVKLKPKMVTMVEIDQMVIDGCKKYMRKTCGDVLDNLKGDCYQVLIEDCIPVLKRYAKEGREFDYVINDLTAVPISTSPEEDSTWEFLRLILDLSMKVLKQDGKYFTQGNCVNLTEALSLYEEQLGRLYCPVEFSKEIVCVPSYLELWVFYTVWKKAKP

• Full Name: spermine synthase
• Calculated Molecular Weight: 366 aa, 41 kDa
• Observed Molecular Weight: 41 kDa
• GenBank Accession Number: BC009898
• Gene Symbol: SMS
• Gene ID (NCBI): 6611
• RRID: AB_2918782
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P52788
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.