SNCB Monoclonal antibody, PBS Only

• 

  WB analysis using 68046-1-Ig (same clone as 68046-1-PBS)

  Brain tissues were subjected to SDS PAGE followed by western blot with 68046-1-Ig (SNCB antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 68046-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 68046-1-Ig (same clone as 68046-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using SNCB antibody (68046-1-Ig, Clone: 2B10E10 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68046-1-PBS in a different storage buffer formulation.

SNCB Monoclonal Antibody for WB, IF-P, Indirect ELISA

Cat No. 68046-1-PBS

Clone No.2B10E10

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat, pig, rabbit, chicken

Applications

WB, IF-P, Indirect ELISA

Synonyms

Beta synuclein, SNCB, synuclein, beta

---

Product Information

68046-1-PBS targets SNCB in WB, IF-P, Indirect ELISA applications and shows reactivity with Human, mouse, rat, pig, rabbit, chicken samples.

• Tested Reactivity: Human, mouse, rat, pig, rabbit, chicken
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0772

  Product name: Recombinant human SNCB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-134 aa of BC002902

  Sequence: MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA

• Full Name: synuclein, beta
• Calculated Molecular Weight: 14 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC002902
• Gene Symbol: SNCB
• Gene ID (NCBI): 6620
• RRID: AB_2918788
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q16143
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.