SNIP/p140Cap Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SNIP/p140Cap Polyclonal antibody, PBS Only (29890-1-PBS)

• 

  WB analysis using 29890-1-AP (same clone as 29890-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29890-1-AP (SNIP antibody) at dilution of 1:30000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29890-1-PBS in a different storage buffer formulation.

SNIP/p140Cap Polyclonal Antibody for WB, Indirect ELISA

Cat No. 29890-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

29890-1-PBS targets SNIP/p140Cap in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31857

  Product name: Recombinant human SNIP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1011-1182 aa of

  Sequence: RSFPSSHGLTTTRTGEVVVTSKKDSAFIKKAESEELEVQKPQVKLRRAVSEVARPASTPPIMASAIKDEDDEDRIIAELESGGGSVPPMKVVTPGASRLKAAQGQAGSPDKSKHGKQRAEYMRIQAQQQATKPSKEMSGSNETSSPVSEKPSASRTSIPVLTSFGARNSSIS

• Full Name: SNAP25-interacting protein
• Calculated Molecular Weight: 127 kDa
• Observed Molecular Weight: 145 kDa
• Gene Symbol: SNIP
• Gene ID (NCBI): 80725
• RRID: AB_3086180
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9C0H9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SNIP, also named SRC kinase signaling inhibitor 1 (SRCIN1) and p140 Cas-associated protein (p140CAP), contains two regions of highly charged amino acids, two proline-rich regions, and two coiled-coil domains. SNIP plays a role in SRC inactivation and acts as a tumor suppressor gene in cancers. MiR-32 suppresses the expression of SNIP, thereby suppressing proliferation and epithelial-mesenchymal transition (EMT) of human liver cancer cells (PMID: 28550679).