Home
Products
Primary Antibodies
SNN Polyclonal antibody, PBS Only (13914-1-PBS)

Filter: AllIHCIF/ICC

IHC staining of mouse brain using 13914-1-AP (same clone as 13914-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 13914-1-AP (SNN antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13914-1-PBS in a different storage buffer formulation.
IHC staining of mouse skeletal muscle using 13914-1-AP (same clone as 13914-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 13914-1-AP (SNN antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13914-1-PBS in a different storage buffer formulation.
IHC staining of mouse skeletal muscle using 13914-1-AP (same clone as 13914-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 13914-1-AP (SNN antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13914-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 13914-1-AP (same clone as 13914-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 13914-1-AP (SNN antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13914-1-PBS in a different storage buffer formulation.
IF Staining of U2OS using 13914-1-AP (same clone as 13914-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed U2OS cells using 13914-1-AP (SNN antibody), at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 13914-1-PBS in a different storage buffer formulation.
IF Staining of U2OS using 13914-1-AP (same clone as 13914-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed U2OS cells using SNN antibody (13914-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 13914-1-PBS in a different storage buffer formulation.

SNN Polyclonal antibody, PBS Only

Name: SNN Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 13914-1-PBS

SNN Polyclonal Antibody for IHC, IF/ICC, Indirect ELISA

Cat No. 13914-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF/ICC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

The antibody is only suitable for IF and IHC detection.

Product Information

13914-1-PBS targets SNN in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag4909 Product name: Recombinant human SNN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-88 aa of BC036443 Sequence: MSIMDHSPTTGVVTVIVILIAIAALGALILGCWCYLRLQRISQSEDEESIVGDGETKEPFLLVQYSAKGPCVERKAKLMTPNGPEVHG Predict reactive species
Full Name	stannin
Calculated Molecular Weight	9 kDa
GenBank Accession Number	BC036443
Gene Symbol	SNN
Gene ID (NCBI)	8303
RRID	AB_2918033
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	O75324
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Stannin (Snn) is discovered using subtractive hybridization methodology designed to find gene products related to selective organotin toxicity and apoptosis. It is present in TMT-sensitive cells and may play a role in the selective toxicity of organotin compounds.