SNRPD1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SNRPD1 Polyclonal antibody, PBS Only (10352-1-PBS)

• 

  WB analysis of HEK-293 using 10352-1-AP (same clone as 10352-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 10352-1-AP (SNRPD1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10352-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 10352-1-AP (same clone as 10352-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 10352-1-AP (SNRPD1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10352-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HL-60 using 10352-1-AP (same clone as 10352-1-PBS)

  HL-60 cells were subjected to SDS PAGE followed by western blot with 10352-1-AP (SNRPD1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10352-1-PBS in a different storage buffer formulation.

SNRPD1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 10352-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

10352-1-PBS targets SNRPD1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0364

  Product name: Recombinant human SNRPD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-119 aa of BC001721

  Sequence: MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR

• Full Name: small nuclear ribonucleoprotein D1 polypeptide 16kDa
• Calculated Molecular Weight: 16 kDa
• Observed Molecular Weight: 13 kDa
• GenBank Accession Number: BC001721
• Gene Symbol: SNRPD1
• Gene ID (NCBI): 6632
• RRID: AB_2193875
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P62314
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Systemic lupus erythematosus is characterized by antibodies to a variety of intracellular self-antigens, such as dsDNA and Sm, and these serve as hallmarks in the diagnosis of systemic autoimmune diseases. SNRPD1 is one Sm components of the small nuclear ribonucleoprotein complexes(snRNPs). It's a charged protein scaffold to promote snRNP assembly or strengthen snRNP-snRNP interactions through nonspecific electrostatic contacts with RNA. This antibody detectes 13-16 kDa (SMD1) and 30 kDa (SMD1/SMD2 dimer form; PMID:15525645).