SNRPD2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SNRPD2 Polyclonal antibody (14789-1-AP)

SNRPD2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 14789-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IP, CoIP, ELISA

Synonyms

Sm D2, SMD2, snRNP core protein D2, SNRPD2

• 

  WB analysis of A2780 using 14789-1-AP

  A2780 cells were subjected to SDS PAGE followed by western blot with 14789-1-AP (SNRPD2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A2780 using 14789-1-AP

  A2780 cells were subjected to SDS PAGE followed by western blot with 14789-1-AP (SNRPD2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HL-60 using 14789-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 14789-1-AP (SNRPD2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HL-60 using 14789-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 14789-1-AP (SNRPD2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A549 using 14789-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 14789-1-AP (SNRPD2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A549 using 14789-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 14789-1-AP (SNRPD2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin using 14789-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 14789-1-AP (SNRPD2 Antibody) at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung using 14789-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 14789-1-AP (SNRPD2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung using 14789-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 14789-1-AP (SNRPD2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 14789-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 14789-1-AP (SNRPD2 Antibody) at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 14789-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 14789-1-AP (SNRPD2 Antibody) at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin using 14789-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 14789-1-AP (SNRPD2 Antibody) at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: A2780 cells, A549 cells, HL-60 cells
• Positive IHC detected in: human skin tissue, human lung cancer tissue, human lung tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2400
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14789-1-AP targets SNRPD2 in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6443

  Product name: Recombinant human SNRPD2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-118 aa of BC000486

  Sequence: MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK

• Full Name: small nuclear ribonucleoprotein D2 polypeptide 16.5kDa
• Calculated Molecular Weight: 14 kDa
• Observed Molecular Weight: 14-16 kDa
• GenBank Accession Number: BC000486
• Gene Symbol: SNRPD2
• Gene ID (NCBI): 6633
• RRID: AB_10898359
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P62316
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Systemic lupus erythematosus is characterized by antibodies to a variety of intracellular self-antigens, such as dsDNA and Sm, and these serve as hallmarks in the diagnosis of systemic autoimmune diseases. SNRPD2 is one of Sm protein, and is required for pre-mRNA splicing, snRNP biogenesis.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Death Dis; TRIM26-mediated NKRF degradation drives Osimertinib resistance through SNRPD2-dependent stress granule formation in lung adenocarcinoma.; Authors - Tao Wang
mouse	WB	Autophagy; Byakangelicin alleviates metabolic dysfunction-associated steatohepatitis by selective inhibition of a non-canonical MTORC1 signaling pathway.; Authors - Xiliang Du
human	WB,IP,IHC,CoIP	Adv Sci (Weinh); Dual Targeting of Mutant p53 and SNRPD2 via Engineered Exosomes Modulates Alternative Splicing to Suppress Ovarian Cancer.; Authors - Wei Zhao
human	WB	RNA Biol; Nuclear retention element recruits U1 snRNP components to restrain spliced lncRNAs in the nucleus.; Authors - Sikandar Azam
		Mol Cell; SMD2 reads pseudouridines to regulate mRNA splicing and promote tumorigenesis.; Authors - Wei-Ying Meng