Home
Products
Primary Antibodies
SNRPD3 Polyclonal antibody, PBS Only (10379-1-PBS)

Filter: AllWBIHC

WB analysis of MCF-7 using 10379-1-AP (same clone as 10379-1-PBS)
MCF7 cells were subjected to SDS PAGE followed by western blot with 10379-1-AP (SNRPD3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10379-1-PBS in a different storage buffer formulation.
WB analysis of MCF-7 using 10379-1-AP (same clone as 10379-1-PBS)
MCF7 cells were subjected to SDS PAGE followed by western blot with 10379-1-AP (SNRPD3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10379-1-PBS in a different storage buffer formulation.
IHC staining of human small intestine using 10379-1-AP (same clone as 10379-1-PBS)
Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 10379-1-AP (SNRPD3 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 10379-1-PBS in a different storage buffer formulation.
IHC staining of human small intestine using 10379-1-AP (same clone as 10379-1-PBS)
Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 10379-1-AP (SNRPD3 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 10379-1-PBS in a different storage buffer formulation.
IHC staining of human lung cancer using 10379-1-AP (same clone as 10379-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10379-1-AP (SNRPD3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10379-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 10379-1-AP (same clone as 10379-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10379-1-AP (SNRPD3 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 10379-1-PBS in a different storage buffer formulation.
IHC staining of human lung cancer using 10379-1-AP (same clone as 10379-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10379-1-AP (SNRPD3 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 10379-1-PBS in a different storage buffer formulation.
IHC staining of human lung cancer using 10379-1-AP (same clone as 10379-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10379-1-AP (SNRPD3 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 10379-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 10379-1-AP (same clone as 10379-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10379-1-AP (SNRPD3 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 10379-1-PBS in a different storage buffer formulation.

SNRPD3 Polyclonal antibody, PBS Only

Name: SNRPD3 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 10379-1-PBS

SNRPD3 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 10379-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

10379-1-PBS targets SNRPD3 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag0293 Product name: Recombinant human SNRPD3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 14-119 aa of BC000457 Sequence: EGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRG Predict reactive species
Full Name	small nuclear ribonucleoprotein D3 polypeptide 18kDa
Calculated Molecular Weight	18 kDa
Observed Molecular Weight	14 kDa
GenBank Accession Number	BC000457
Gene Symbol	SNRPD3
Gene ID (NCBI)	6634
RRID	AB_2286308
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P62318
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Small nuclear ribonucleoprotein D3 polypeptide 18kDa (SNRPD3,synonym: SMD) belongs to the small nuclear ribonucleoprotein core protein family, with molecular weights of the D members: D1,16 kDa; D2, 16.5 kDa and D3 18 kDa. SNRPD3 is required for pre-mRNA splicing and small nuclear ribonucleoprotein biogenesis.