SNTB2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SNTB2 Polyclonal antibody, PBS Only (19027-1-PBS)

• 

  WB analysis using 19027-1-AP (same clone as 19027-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 19027-1-AP (SNTB2 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 19027-1-PBS in a different storage buffer formulation.

SNTB2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 19027-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Syntrophin-like, Syntrophin-3, Beta-2-syntrophin, Beta 2 syntrophin, 59 kDa dystrophin-associated protein A1 basic component 2

---

Product Information

19027-1-PBS targets SNTB2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13504

  Product name: Recombinant human SNTB2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-300 aa of BC048215

  Sequence: MRVAAATAAAGAGPAMAVWTRATKAGLVELLLRERWVRVVAELSGESLSLTGDAAAAELEPALGPAAAAFNGLPNGGGAGDSLPGSPSRGLGPPSPPAPPRGPAGEAGASPPVRRVRVVKQEAGGLGISIKGGRENRMPILISKIFPGLAADQSRALRLGDAILSVNGTDLRQATHDQAVQALKRAGKEVLLEVKFIREVTPYIKKPSLVSDLPWEGAAPQSPSFSGSEDSGSPKHQNSTKDRKIIPLKMCFAARNLSMPDLENRLIELHSPDSRNTLILRCKDTATAHSWFVAIHTNIM

• Full Name: syntrophin, beta 2 (dystrophin-associated protein A1, 59kDa, basic component 2)
• Calculated Molecular Weight: 540 aa, 58 kDa
• Observed Molecular Weight: 50-60 kDa
• GenBank Accession Number: BC048215
• Gene Symbol: SNTB2
• Gene ID (NCBI): 6645
• RRID: AB_3741958
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13425
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Syntrophin beta 2(SNTB2) also known as SNT3 and SNTL, belongs to the syntrophin family. SNTB2 is a peripheral membrane protein associated with dystrophin and antimyotrophin-associated protein complexes.