SNX21 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SNX21 Polyclonal antibody, PBS Only (22193-1-PBS)

• 

  WB analysis of HepG2 using 22193-1-AP (same clone as 22193-1-PBS)

  WB result of SNX21 (22193-1-AP, 1:500) with si-control and si-SNX21 transfected HepG2 cells. This data was developed using the same antibody clone with 22193-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 22193-1-AP (same clone as 22193-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 22193-1-AP (SNX21 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 22193-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 22193-1-AP (same clone as 22193-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 22193-1-AP (SNX21 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 22193-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SNX21 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 22193-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

22193-1-PBS targets SNX21 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16900

  Product name: Recombinant human SNX21 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-199 aa of BC019823

  Sequence: MHRGTQEGAMASRLLHRLRHALAGDGPGEAAASPEAEQFPESSELEDDDAEGLSSRLSGTLSFTSAEDDEDDEDEDDEEAGPDQLPLGDGTSGEDAERSPPPDGQWGSQLLARQLQDFWKKSRNTLAPQRLLFEVTSANVVKDPPSKYVLYTLTVIGPGPPDCQPAQISRRYSDFERLHRNLQRQFRGPMAAISFPQSH

• Full Name: sorting nexin family member 21
• Calculated Molecular Weight: 373 aa, 41 kDa
• Observed Molecular Weight: ~40 kDa
• GenBank Accession Number: BC019823
• Gene Symbol: SNX21
• Gene ID (NCBI): 90203
• RRID: AB_2879022
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q969T3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SNX21, also named as C20orf161 and SNXL, is a member of the sorting nexin family. It binds to membranes enriched in phosphatidylinositol 3-phosphate (PtdIns(P3)) and phosphatidylinositol 4,5-bisphosphate. It is involved in several stages of intracellular trafficking.