SNX27 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• SNX27 Recombinant monoclonal antibody (87039-1-RR)

• 

  WB analysis using 87039-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87039-1-RR (SNX27 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse kidney using 87039-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 87039-1-RR (SNX27 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 87039-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 87039-1-RR (SNX27 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  Affinity of 87039-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87039-1-RR against Human SNX27 were performed. The affinity constant is 0.572 nM.

SNX27 Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 87039-1-RR

Clone No.252134D11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

KIAA0488, My014, Sorting nexin-27

---

Tested Applications

• Positive WB detected in: K-562 cells, HeLa cells, Jurkat cells, HEK-293 cells, 3T3-L1 cells, NIH/3T3 cells, HSC-T6 cells
• Positive IHC detected in: mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87039-1-RR targets SNX27 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag29226

  Product name: Recombinant human SNX27 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-100 aa of BC012184

  Sequence: MDSTTVNYFALFEVISHSFVRKLAPNEFPHKLYIQNYTSAVPGTCLTIRKWLFTTEEEILLNDNDLAVTYFFHQAVDDVKKGYIKAEEKSYQLQKLYEQR

• Full Name: sorting nexin family member 27
• Calculated Molecular Weight: 61 kDa, 60 kDa, 52 kDa, 28 kDa
• Observed Molecular Weight: 61 kDa
• GenBank Accession Number: BC012184
• Gene Symbol: SNX27
• Gene ID (NCBI): 81609
• RRID: AB_3745293
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96L92
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Sorting nexin 27 (SNX27), a PDZ domain-containing protein, belongs to the sorting nexin family of proteins. SNX27 promotes the recycling of internalized transmembrane proteins from endosomes to the plasma membrane by linking PDZ-dependent cargo recognition to retromer-mediated transport (PMID: 21602791; 23563491). It has been shown that SNX27 deficiency contributes to synaptic and cognitive deficits by modulating glutamate receptor recycling in Down's syndrome (PMID: 23524343). SNX27 has also been proposed to have a role in regulating β-amyloid (Aβ) generation by modulating γ-secretase activity, which is a molecular mechanism for Aβ-dependent pathogenesis in both Down's syndrome and Down's syndrome (PMID: 25437557).