Product Information
87039-1-PBS targets SNX27 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag29226 Product name: Recombinant human SNX27 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC012184 Sequence: MDSTTVNYFALFEVISHSFVRKLAPNEFPHKLYIQNYTSAVPGTCLTIRKWLFTTEEEILLNDNDLAVTYFFHQAVDDVKKGYIKAEEKSYQLQKLYEQR Predict reactive species |
| Full Name | sorting nexin family member 27 |
| Calculated Molecular Weight | 61 kDa, 60 kDa, 52 kDa, 28 kDa |
| Observed Molecular Weight | 61 kDa |
| GenBank Accession Number | BC012184 |
| Gene Symbol | SNX27 |
| Gene ID (NCBI) | 81609 |
| RRID | AB_3745293 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q96L92 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Sorting nexin 27 (SNX27), a PDZ domain-containing protein, belongs to the sorting nexin family of proteins. SNX27 promotes the recycling of internalized transmembrane proteins from endosomes to the plasma membrane by linking PDZ-dependent cargo recognition to retromer-mediated transport (PMID: 21602791; 23563491). It has been shown that SNX27 deficiency contributes to synaptic and cognitive deficits by modulating glutamate receptor recycling in Down's syndrome (PMID: 23524343). SNX27 has also been proposed to have a role in regulating β-amyloid (Aβ) generation by modulating γ-secretase activity, which is a molecular mechanism for Aβ-dependent pathogenesis in both Down's syndrome and Down's syndrome (PMID: 25437557).
