CoraLite® Plus 488-conjugated SNX9 Monoclonal antibody

SNX9 Monoclonal Antibody for IF/ICC
Cat No. CL488-68255
Clone No.1B11C9

Host / Isotype

Mouse / IgG2a

Reactivity

Human, mouse, rat

Applications

IF/ICC

MST155, MSTP155, Protein SDP1, SDP1, SH3PX1, SH3PXD3A, SNX9, sorting nexin 9, WISP

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inA431 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68255 targets SNX9 in IF/ICC applications and shows reactivity with Human, mouse, rat samples.

Tested Reactivity Human, mouse, rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8446

Product name: Recombinant human SNX9 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-362 aa of BC005022

Sequence: MATKARVMYDFAAEPGNNELTVNEGEIITITNPDVGGGWLEGRNIKGERGLVPTDYVEILPSDGKDQFSCGNSVADQAFLDSLSASTAHASSSAASNNHQVGSGNDPWSAWSASKSGNWESSEGWGAQPEGAGAQRNTNTPNNWDTAFGHPQAYQGPATGDDDDWDEDWDGPKSSSYFKDSESADAGGAQRGNSRASSSSMKIPLNKFPGFAKPGTEQYLLAKQLAKPKEKIPIIVGDYGPMWVYPTSTFDCVVADPRKGSKMYGLKSYIEYQLTPTNTNRSVNHRYKHFDWLYERLLVKFGSAIPIPSLPDKQVTGRFEEEFIKMRMERLQAWMTRMCRHPVISESEVFQQFLNFRDEKEW

Predict reactive species
Full Name sorting nexin 9
Calculated Molecular Weight 595 aa, 67 kDa
Observed Molecular Weight70 kDa
GenBank Accession NumberBC005022
Gene Symbol SNX9
Gene ID (NCBI) 51429
RRIDAB_3084459
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9Y5X1
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Sorting nexins are a diverse group of cytoplasmic and membrane-associated proteins that are classified by the presence of a phospholipid-binding motif-the PX domain (PMID:12461558). They are involved in endocytosis and protein trafficking. SNX9 (Sorting nexin-9, also known as SH3PX1) was originally identified as a protein that interacted with the metalloproteinases ADAM9 and ADAM15. It contains a PX and an Sec homology 3 (SH3) domain. SNX9 functions in clathrin-mediated endocytosis and clathrin-independent, actin-dependent fluid-phase endocytosis (PMID: 17609109). On SDS-PAGE, SNX9 migrates at a molecular weight (70-78 kDa) higher than its calculated molecular mass of 67 kDa (PMID: 15299020; 12952949; 18411244; 15703209).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 SNX9 antibody CL488-68255Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...