SOCS4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SOCS4 Polyclonal antibody, PBS Only (27191-1-PBS)

SOCS4 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 27191-1-PBS Copied!

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

• 

  WB analysis using 27191-1-AP (same clone as 27191-1-PBS)

  Mouse liver tissue were subjected to SDS PAGE followed by western blot with 27191-1-AP (SOCS4 antibody) at dilution of 1:30000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27191-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SOCS4 in ?

Chat with Able

---

Product Information

27191-1-PBS targets SOCS4 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25887

  Product name: Recombinant human SOCS4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-118 aa of BC060790

  Sequence: MAENNENISKNVDVRPKTSRSRSADRKDGYVWSGKKLSWSKKSESYSDAETVNGIEKTEVSLRNQERKHSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSSRHSSGLPS

• Full Name: suppressor of cytokine signaling 4
• Calculated Molecular Weight: 51 kDa
• Observed Molecular Weight: 51 kDa
• GenBank Accession Number: BC060790
• Gene Symbol: SOCS4
• Gene ID (NCBI): 122809
• RRID: AB_3669587
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WXH5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SOCS4 contains a SH2 domain and a SOCS BOX domain, and belongs to Suppressors of cytokine signaling (SOCS) family. SOCS family members are known to be cytokine-inducible negative regulators of cytokine signaling.