SON Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83787-5-RR (same clone as 83787-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83787-5-RR (SON antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83787-5-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 83787-5-RR (same clone as 83787-5-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 83787-5-RR (SON antibody) at dilution of 1:600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83787-5-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 83787-5-RR (same clone as 83787-5-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using SON antibody (83787-5-RR, Clone: 240845B7 ) at dilution of 1:250 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 83787-5-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 83787-5-RR (same clone as 83787-5-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using SON antibody (83787-5-RR, Clone: 240845B7 ) at dilution of 1:250 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 83787-5-PBS in a different storage buffer formulation.

• 

  FC experiment of A431 using 83787-5-RR (same clone as 83787-5-PBS)

  1x10^6 A431 cells were intracellularly stained with 0.25 ug SON Recombinant antibody (83787-5-RR, Clone:240845B7) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with True-Nuclear Transcription Factor Buffer Set. This data was developed using the same antibody clone with 83787-5-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 83787-5-RR (same clone as 83787-5-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug SON Recombinant antibody (83787-5-RR, Clone:240845B7) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with True-Nuclear Transcription Factor Buffer Set. This data was developed using the same antibody clone with 83787-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83787-5-RR

  Biolayer interferometry (BLl) kinetic assays of 83787-5-RR against Human SON were performed. The affinity constant is 0.591 nM.

SON Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 83787-5-PBS

Clone No.240845B7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

SON DNA binding protein, KIAA1019, HSPC312, DBP5, C21orf50

---

Product Information

83787-5-PBS targets SON in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag27620

  Product name: Recombinant human SON protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 14-182 aa of NM_001291411

  Sequence: MVSKFREIQQELSSGRNEGQLNGETNTPIEGNQAGDAAASARSLPNEEIVQKIEEVLSGVLDTELRYKPDLKEGSRKSRCVSVQTDPTDEIPTKKSKKHKKHKNKKKKKKKEKEKKYKRQPEESESKTKSHDDGNIDLESDSFLKFDSEPSAVALELPTRAFGPSETNES

• Full Name: SON DNA binding protein
• Calculated Molecular Weight: 264 aa
• Observed Molecular Weight: 250-300 kDa
• GenBank Accession Number: NM_001291411
• Gene Symbol: SON
• Gene ID (NCBI): 6651
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P18583
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SON, also called C21orf50 and DBP5, is a nuclear speckle-localized protein that shares homology with pre-mRNA splicing accessory factors (PMID: 10950926). It is an RNA-binding protein that acts as an mRNA splicing cofactor by promoting efficient splicing of transcripts that possess weak splice sites, and specifically promotes splicing of many cell-cycle and DNA-repair transcripts that possess weak splice sites, such as TUBG1, KATNB1, TUBGCP2, AURKB, PCNT, AKT1, RAD23A, and FANCG (PMID: 20581448; 21504830).