SORBS1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SORBS1 Polyclonal antibody, PBS Only (13854-1-PBS)

• 

  WB analysis of 3T3-L1 using 13854-1-AP (same clone as 13854-1-PBS)

  3T3-L1 cells were subjected to SDS PAGE followed by western blot with 13854-1-AP (SORBS1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13854-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 13854-1-AP (same clone as 13854-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 13854-1-AP (SORBS1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13854-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse kidney using 13854-1-AP (same clone as 13854-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 13854-1-AP (SORBS1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13854-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 13854-1-AP (same clone as 13854-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 13854-1-AP (SORBS1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13854-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse kidney using 13854-1-AP (same clone as 13854-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 13854-1-AP (SORBS1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13854-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse liver using 13854-1-AP (same clone as 13854-1-PBS)

  IP result of anti-SORBS1 (IP:13854-1-AP, 4ug; Detection:13854-1-AP 1:800) with mouse liver tissue lysate 4800ug. This data was developed using the same antibody clone with 13854-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 13854-1-AP (same clone as 13854-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human normal colon slide using 13854-1-AP (SORBS1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13854-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach using 13854-1-AP (same clone as 13854-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 13854-1-AP (SORBS1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13854-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SORBS1 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 13854-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

CAP, c-Cbl-associated protein, SH3D5, SORB1, Sorbin and SH3 domain-containing protein 1

---

Product Information

13854-1-PBS targets SORBS1 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4828

  Product name: Recombinant human SORBS1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-300 aa of BC042612

  Sequence: MSSECDGGSKAVMNGLAPGSNGQDKDMDPTKICTGKGAVTLRASSSYRETPSSSPASPQETRQHESKPDEWRLSSSADANGNAQPSSLAAKGYRSVHPNLPSDKSQDATSSSAAQPEVIVVPLYLVNTDRGQEGTARPPTPLGPLGCVPTIPATASAASPLTFPTLDDFIPPHLQRWPHHSQPARASGSFAPISQTPPSFSPPPPLVPPAPEDLRRVSEPDLTGAVSSTDSSPLLNEVSSSLIGTDSQAFPSVSKPSSAYPSTTIVNPTIVLLQHNREQQKRLSSLSDPVSERRVGEQDS

• Full Name: sorbin and SH3 domain containing 1
• Calculated Molecular Weight: 1292 aa, 142 kDa
• Observed Molecular Weight: 70-75 kDa
• GenBank Accession Number: BC042612
• Gene Symbol: SORBS1
• Gene ID (NCBI): 10580
• RRID: AB_11232224
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BX66
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The sorbin homology (SoHo) family of adapter and scaffold proteins consists of three proteins: CAP, also known as Sorbin and SH3 domain containing 1 (Sorbs1), ArgBP2, also known as Sorbs2, and Vinexin, also known as Sorbs3. All Sorbs proteins are highly expressed in heart tissue, skeletal muscle, adipose tissue, and cells of the immune system, functioning as SH3-domain-mediated adaptors of scaffolding molecules(PMID: 32738595). SORBS1 can bind to signaling molecules (e.g., c-Cbl, c-Abl, and insulin reporter) to regulate glucose transport, transcription activity, and insulin signaling(PMID: 27791200).