SORLA Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• SORLA Recombinant monoclonal antibody (87882-1-RR)

• 

  WB analysis using 87882-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87882-1-RR (SORL antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of mouse brain using 87882-1-RR

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using SORLA antibody (87882-1-RR, Clone: 253502E4 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  Affinity of 87882-1-RR

  Biolayer interferometry (BLI) kinetic assays of 87882-1-RR against Human SORLA were performed. The affinity constant is 2.06 nM.

SORLA Uni-rAb^® Recombinant Antibody for WB, IF-P, ELISA

Cat No. 87882-1-RR

Clone No.253502E4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF-P, ELISA

Synonyms

SORL1, C11orf32, LDLR relative with 11 ligand-binding repeats, Low-density lipoprotein receptor relative with 11 ligand-binding repeats, SORL 1

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87882-1-RR targets SORLA in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg5593

  Product name: Recombinant human SORL protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 82-181 aa of NM_003105.6

  Sequence: SAALQPEPIKVYGQVSLNDSHNQMVVHWAGEKSNVIVALARDSLALARPKSSDVYVSYDYGKSFKKISDKLNFGLGNRSEAVIAQFYHSPADNKRYIFAD

• Full Name: sortilin-related receptor, L(DLR class) A repeats-containing
• Calculated Molecular Weight: 248 kDa
• Observed Molecular Weight: 300-310 kDa
• GenBank Accession Number: NM_003105.6
• Gene Symbol: SORLA
• Gene ID (NCBI): 6653
• RRID: AB_3745807
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q92673
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SorLA also known as SorL1 or LR11, is a multiligand receptor belonging to the LDL receptor superfamily. It is also a member of vacuolar protein sorting-10 (Vps10) family and is enriched in the brain. SorLA acts as an sorting receptor for APP and prevents amyloidogenic processing of APP. Downregulation of SorLA has been found in patients with sporadic Alzheimer disease (AD). Currently SorLA has emerged as a potential target for AD therapy. (25404298)