Tested Applications
| Positive WB detected in | mouse brain tissue, rat brain tissue |
| Positive IF-P detected in | mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
87882-1-RR targets SORLA in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg5593 Product name: Recombinant human SORL protein Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 82-181 aa of NM_003105.6 Sequence: SAALQPEPIKVYGQVSLNDSHNQMVVHWAGEKSNVIVALARDSLALARPKSSDVYVSYDYGKSFKKISDKLNFGLGNRSEAVIAQFYHSPADNKRYIFAD Predict reactive species |
| Full Name | sortilin-related receptor, L(DLR class) A repeats-containing |
| Calculated Molecular Weight | 248 kDa |
| Observed Molecular Weight | 300-310 kDa |
| GenBank Accession Number | NM_003105.6 |
| Gene Symbol | SORLA |
| Gene ID (NCBI) | 6653 |
| RRID | AB_3745807 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q92673 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SorLA also known as SorL1 or LR11, is a multiligand receptor belonging to the LDL receptor superfamily. It is also a member of vacuolar protein sorting-10 (Vps10) family and is enriched in the brain. SorLA acts as an sorting receptor for APP and prevents amyloidogenic processing of APP. Downregulation of SorLA has been found in patients with sporadic Alzheimer disease (AD). Currently SorLA has emerged as a potential target for AD therapy. (25404298)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SORLA antibody 87882-1-RR | Download protocol |
| WB protocol for SORLA antibody 87882-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





