Product Information
30613-1-PBS targets SOX14 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag31127 Product name: Recombinant human SOX14 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 85-155 aa of BC106730 Sequence: NLLKKDRYVFPLPYLGDTDPLKAAGLPVGASDGLLSAPEKARAFLPPASAPYSLLDPAQFSSSAIQKMGEV Predict reactive species |
| Full Name | SRY (sex determining region Y)-box 14 |
| Calculated Molecular Weight | 240 aa, 26 kDa |
| Observed Molecular Weight | 26 kDa |
| GenBank Accession Number | BC106730 |
| Gene Symbol | SOX14 |
| Gene ID (NCBI) | 8403 |
| RRID | AB_3742359 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O95416 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
SOX14, also known as SOX28, is a member of the SOX (SRY-related HMG-box) family of transcription factors. This intronless gene encodes a protein that acts as a transcriptional regulator after forming complexes with other proteins. It is involved in embryonic development and cell fate determination. SOX14 is primarily expressed in the nervous system, where it plays a role in neuronal differentiation and circuit formation. Mutations in SOX14 are suggested to be responsible for limb defects associated with conditions such as blepharophimosis, ptosis, epicanthus inversus syndrome (BPES), and Moebius syndrome. Additionally, SOX14 has been implicated in tumor development, with studies indicating its involvement in cervical cancer through mechanisms such as the p53 and Wnt/β-catenin pathways. (PMID: 34098886, PMID: 34181293)

