• Featured Product
  • KD/KO Validated

SOX4 Recombinant monoclonal antibody, PBS Only (Capture)

SOX4 Uni-rAb® Recombinant Antibody for WB, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 83660-1-PBS
Clone No.240625E3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

240625E3, CSS10, EVI16, Transcription factor SOX-4

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83660-1-PBS targets SOX4 as part of a matched antibody pair:

MP00619-1: 83660-1-PBS capture and 83660-3-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag26583

Product name: Recombinant human SOX4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 70-160 aa of BC072668

Sequence: SQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIREAERLRLKHMADYPDYKYRPRKKVKSGNANSSSSAAASSKPGEKGDKVGG

Predict reactive species
Full Name SRY (sex determining region Y)-box 4
Calculated Molecular Weight 474 aa, 47 kDa
Observed Molecular Weight47 kDa
GenBank Accession NumberBC072668
Gene Symbol SOX4
Gene ID (NCBI) 6659
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ06945
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

SOX4 is a member of the SOX (SRY-related HMG-box) family of transcription factors that play key roles in the regulation of stemness, differentiation, progenitor cell development, and multiple developmental pathways. A single-exon gene encodes the SOX4 protein and contains a highly conserved high-mobility group (HMG) DNA binding domain related to the TCF/LEF family of transcription factors that play important roles in the Wnt pathway. SOX4 is expressed in stem cells, and modulates stem cell activation and likely also plays a role in stem cell maintenance, possibly through activation of expression of SOX2 (PMID: 23764001, 31445218). The calculated molecular weight of SOX4 is 47 kDa.

Loading...
||
New chat

Able

正在加载,请稍候...