• Featured Product
  • KD/KO Validated

SOX4 Recombinant monoclonal antibody

SOX4 Uni-rAb® Recombinant Antibody for WB, FC (Intra), ELISA
Cat No. 83660-1-RR
Clone No.240625E3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), ELISA

240625E3, CSS10, EVI16, Transcription factor SOX-4

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, A431 cells, MCF-7 cells, SGC-7901 cells
Positive FC (Intra) detected inSH-SY5Y cells, HeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83660-1-RR targets SOX4 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag26583

Product name: Recombinant human SOX4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 70-160 aa of BC072668

Sequence: SQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIREAERLRLKHMADYPDYKYRPRKKVKSGNANSSSSAAASSKPGEKGDKVGG

Predict reactive species
Full Name SRY (sex determining region Y)-box 4
Calculated Molecular Weight 474 aa, 47 kDa
Observed Molecular Weight47 kDa
GenBank Accession NumberBC072668
Gene Symbol SOX4
Gene ID (NCBI) 6659
RRIDAB_3671267
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ06945
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SOX4 is a member of the SOX (SRY-related HMG-box) family of transcription factors that play key roles in the regulation of stemness, differentiation, progenitor cell development, and multiple developmental pathways. A single-exon gene encodes the SOX4 protein and contains a highly conserved high-mobility group (HMG) DNA binding domain related to the TCF/LEF family of transcription factors that play important roles in the Wnt pathway. SOX4 is expressed in stem cells, and modulates stem cell activation and likely also plays a role in stem cell maintenance, possibly through activation of expression of SOX2 (PMID: 23764001, 31445218). The calculated molecular weight of SOX4 is 47 kDa.

Protocols

Product Specific Protocols
WB protocol for SOX4 antibody 83660-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...