SOX8 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SOX8 Polyclonal antibody (20627-1-AP)

• Featured Product
• KD/KO Validated

SOX8 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 20627-1-AP Copied!

Publications (8)

Reviews (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Transcription factor SOX 8, Transcription factor SOX-8

• 

  WB analysis using 20627-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20627-1-AP (SOX8 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 20627-1-AP

  WB result of SOX8 antibody (20627-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SOX8 transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of COLO 320 using 20627-1-AP

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 20627-1-AP (SOX8 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 20627-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 20627-1-AP (SOX8 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 20627-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 20627-1-AP (SOX8 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 20627-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using 20627-1-AP (SOX8 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SOX8 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue, COLO 320 cells, HeLa cells, rat brain tissue
• Positive IHC detected in: human brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20627-1-AP targets SOX8 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14556

  Product name: Recombinant human SOX8 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 298-446 aa of BC031797

  Sequence: EPGQAYGGAYFHAGASPVWAHKSAPSASASPTETGPPRPHIKTEQPSPGHYGDQPRGSPDYGSCSGQSSATPAAPAGPFAGSQGDYGDLQASSYYGAYPGYAPGLYQYPCFHSPRRPYASPLLNGLALPPAHSPTSHWDQPVYTTLTRP

• Full Name: SRY (sex determining region Y)-box 8
• Calculated Molecular Weight: 446 aa, 47 kDa
• Observed Molecular Weight: 47-55 kDa
• GenBank Accession Number: BC031797
• Gene Symbol: SOX8
• Gene ID (NCBI): 30812
• RRID: AB_10693538
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P57073
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

20627-1-AP is a SOX8 Affinity Purified antibody with 8 total citations. Citations appear in Cell, Redox Biology, Advanced Science, Cancer Cell International, Cancer Biology & Therapy, Carcinogenesis, Molecular Carcinogenesis, and bioRxiv. Research fields span T cell development, hepatocellular carcinoma and ferroptosis, triple-negative breast cancer, NSCLC metastasis, endometrial carcinoma, oral squamous cell carcinoma, and retinal glial differentiation.

Automatically generated from the 8 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Cell; Thymic epithelial cells co-opt lineage-defining transcription factors to eliminate autoreactive T cells.; Authors - Daniel A Michelson
human	WB,IHC	Redox Biol; Excessive SOX8 reprograms energy and iron metabolism to prime hepatocellular carcinoma for ferroptosis; Authors - Xue Yang ; KO Validated
human	WB,IHC	Adv Sci (Weinh); Identification of a Novel Substrate for eEF2K and the AURKA-SOX8 as the Related Pathway in TNBC; Authors - Xiaoya Wan
		Cancer Cell Int; Exosomal circPOLK promotes metastasis of NSCLC cells via regulating mir-1204/SOX8 axis.; Authors - Yang-ling Li
human	IHC	Cancer Biol Ther; The oncogenic role of SOX8 in endometrial carcinoma.; Authors - Wenyan Tian
human	WB,IHC	Carcinogenesis; SOX8 acts as a prognostic factor and mediator to regulate the progression of triple-negative breast cancer.; Authors - Hailin Tang

Reviews

5.0 out of 5

2 verified customer reviews

What customers say

Both reviewers (the same user) gave this antibody a perfect 5-star rating. One review, from November 2025, described it simply as a "good product" after using it for immunofluorescence. The other, from October 2025, stated that "the product worked well for my experiment" when used for both Western blot and immunofluorescence. Both reviews reference the same lot (00098309). Overall, customer feedback is consistently positive, with users reporting reliable performance across multiple applications.

Automatically generated from the 2 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Yashika (Verified Customer) (11-06-2025)

Good product

• Applications: Immunofluorescence

YASHIKA (Verified Customer) (10-02-2025)

The product worked well for my experiment

• Applications: Western Blot, Immunofluorescence