SOX9 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• SOX9 Recombinant monoclonal antibody, PBS Only (86714-3-PBS)

SOX9 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86714-3-PBS

Clone No.253046H2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

CMD1, CMPD1, SRA1, Transcription factor SOX 9, Transcription factor SOX-9

• 

  WB analysis using 86714-3-RR (same clone as 86714-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86714-3-RR (SOX9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86714-3-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity of 86714-3-RR

  Biolayer interferometry (BLl) kinetic assays of 86714-3-RR against Human SOX9 were performed. The affinity constant is 1.12 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

86714-3-PBS targets SOX9 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag26274

  Product name: Recombinant human SOX9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 306-405 aa of NM_000346

  Sequence: MVPATHGQVTYTGSYGISSTAATPASAGHVWMSKQQAPPPPPQQPPQAPPAPQAPPQPQAAPPQQPAAPPQQPQAHTLTTLSSEPGQSQRTHIKTEQLSPS

• Full Name: SRY (sex determining region Y)-box 9
• Calculated Molecular Weight: 56 kDa
• Observed Molecular Weight: 56 kDa
• GenBank Accession Number: NM_000346
• Gene Symbol: SOX9
• Gene ID (NCBI): 6662
• RRID: AB_3745073
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P48436
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SOX9, also named as Transcription factor SOX-9, is a 509 amino acid protein. Sex-determining region Y (SRY)-box 9 protein (SOX9) is a member of the SOX family of transcription factors (TFs) which are developmental regulators that possess high mobility group (HMG) box DNA binding and transactivation domains. It participates in a variety of functions, such as lineage restriction and terminal diferentiation, through precise temporal and spatial expression patterns that difer between particular cell types and tissues. SOX9 gene has been implicated in different types of cancer as an oncogene; however, it also may behave as a tumor suppressor. SOX9 can be ubiquitinated or SUMOylated to higher molecular weight (PMID: 24155239; 16307912; 16554309; 32070068)